KEGG   Sinocyclocheilus rhinocerous: 107713991
Entry
107713991         CDS       T04916                                 

Definition
(RefSeq) transcriptional regulator Myc-B
  KO
K04377  Myc proto-oncogene protein
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04110  Cell cycle
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107713991
   04012 ErbB signaling pathway
    107713991
   04310 Wnt signaling pathway
    107713991
   04350 TGF-beta signaling pathway
    107713991
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107713991
   04218 Cellular senescence
    107713991
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107713991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107713991
   03019 Messenger RNA biogenesis [BR:srx03019]
    107713991
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107713991
Messenger RNA biogenesis [BR:srx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107713991
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 107713991
NCBI-ProteinID: XP_016375169
UniProt: A0A673L857
LinkDB
Position
Unknown
AA seq 390 aa
MPLNSSMASKNYDYDYDSYQPYFYFDNEDEDFYNHQHGQPPAPSEDIWKKFELLPTPPLS
PSRRPSLSDPFPSTADQLEMVSEFLGDDVVNHSFICEADYSQSFLKSIIIQDCMWSGFSA
AAKLEKVVSERLASLQAARKESSRSDSVDGCRSSPNLSYLQDMSTPASQCIDPSVVFPFP
LTDSSKPSKPSSTPTSTTLPLDTPPNSGSSSDSDSDDEEEEEIDVVTVEKRKSVRKPDAN
ATHQSPVVLKRSHVNIHQHNYAAQPSTRSEQPAVKRIKFESNIRVFKQMNHNRKCTSPRT
SDSEDNDKRKTHNVLERQRRNELKLSFFALRDVIPDVANNEKAAKVVILKKATECIATIQ
EDEQKLISLKEQLRRKCEHLKRRLEQLSSS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgctgaattcaagtatggcgagtaaaaattacgattacgactacgattcctaccag
ccctatttctatttcgacaacgaggatgaggatttctataaccaccagcacggacagcca
ccggcgcccagtgaggatatatggaagaaatttgaactgctccccactccgccgctctcc
ccgagccggcgtccctcgctgtcagaccccttcccctccacggccgaccagctggaaatg
gtgtcggagtttctcggggacgacgtggtcaaccacagttttatttgcgaggcggactac
tcccagtcttttctgaagtcgattatcattcaggactgtatgtggagtggtttctccgcc
gcggctaaactggagaaggtggtgtcggagagattagcgtcgctccaggcggcgaggaaa
gagtcttccaggagcgactctgtggacggctgtcggtccagccctaacctcagctacctt
caggacatgagcacccctgcctcacagtgcattgacccatcagtggtgttccctttcccg
ctgactgacagctcaaagccgtctaaaccgtcatccacaccgacttccacaacactgcca
ctggatactccaccaaacagtgggagcagcagtgacagcgattccgatgacgaagaggag
gaggaaatcgacgttgtcacggtggaaaagagaaagtctgtgagaaagcctgacgcaaac
gcaacgcatcaaagccccgtcgtcctcaagcggagccacgttaatattcaccaacacaat
tacgccgcgcagccatccacgcggagcgagcagcctgcggtcaagcggattaaattcgag
agtaacatccgggtgtttaaacaaatgaaccacaaccgtaaatgcacgagtcccaggacg
tcggactctgaggataacgacaaacgcaagactcataacgtgctcgagcggcaacggcgg
aacgagctcaaactcagtttcttcgcgctgagagacgtgattcctgacgtggccaacaac
gagaaagctgccaaagtggtgatactcaagaaggcgacggagtgcatagcgaccatacaa
gaagatgaacaaaaactgatctcacttaaggagcaattaaggaggaaatgtgaacatttg
aaacggagacttgaacagctaagcagttcttaa

KEGG   Sinocyclocheilus rhinocerous: 107724569
Entry
107724569         CDS       T04916                                 

Definition
(RefSeq) transcriptional regulator Myc-1 isoform X1
  KO
K04377  Myc proto-oncogene protein
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04110  Cell cycle
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107724569
   04012 ErbB signaling pathway
    107724569
   04310 Wnt signaling pathway
    107724569
   04350 TGF-beta signaling pathway
    107724569
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107724569
   04218 Cellular senescence
    107724569
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107724569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107724569
   03019 Messenger RNA biogenesis [BR:srx03019]
    107724569
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107724569
Messenger RNA biogenesis [BR:srx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107724569
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 107724569
NCBI-ProteinID: XP_016389034
UniProt: A0A673I229
LinkDB
Position
Unknown
AA seq 391 aa
MPVIASLAYKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPPAPSEDIWKKFELLPTPP
LSPSRRQSLSTAEQLEMVSEFLGDDVVNQSFICDADNSPSFIKSIIIQDCMWSGFSAAAN
LEKVVSERLASLHAARKELMSDSSSNRLNASYLQDMSTSASECIDPSVVFPYPLTESSKS
SKVAPSEPMLVLDTPPNSSSSSGSDSEEEEEEEEEEEEEEEIDVVTVEKRQKRNETEVSD
SRYPSPLVLKRCHVSTHQHNYAAHPSTRHDQPAVKRLRLEASSNNSSRHVKQRKCTSPRT
SDSEDKDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNEKAAKVVILKKATECIHSMQ
LDEQRLLSIKEQLRRKSEQLKHRLQLLRSSH
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccggtgattgcgagtttggcgtataaaaactacgattacgactacgactccatccag
ccctatttctatttcgacaacgacgatgaggatttctatcaccatcagcaaggacagact
caacctccagctcccagcgaggacatatggaagaaattcgagctgctgcccacaccgccc
ctctcacccagccggagacagtcgctctccaccgccgaacagctggagatggtaagcgag
ttcctgggagacgacgtggtcaaccagagcttcatctgcgacgcggacaactccccgtcc
ttcatcaagtccatcatcatccaggactgcatgtggagcggcttttccgccgctgccaat
ttggagaaagtggtttctgagagactagcgtccctgcacgctgctaggaaagaactgatg
tctgacagcagctcaaatcgactcaatgcaagttatttgcaggatatgagcacctctgca
tcagaatgcatcgacccttctgtggtcttcccgtatcccctcacggagtccagcaaatcc
agcaaggttgctccatcagaacccatgcttgtcctggacactccacctaacagctccagc
agcagtggtagcgattctgaagaagaagaggaggaggaggaggaggaagaggaagaagaa
gaaattgatgtggtgactgtggaaaagcgacagaaaagaaacgagacggaggtgtcagat
tcgaggtaccccagtcccctggtgttgaagcgctgtcacgtctccacccaccagcacaac
tacgccgcccacccctccacacggcatgaccagccggctgtcaagaggctacgactggag
gccagcagcaacaacagcagcaggcatgtgaaacaacgcaagtgcacgagtccacggaca
tcggattctgaagacaaagacaaacgcaggactcacaatgtgctggagcgccaacgcaga
aacgaactcaaactcagctttttcgcattacgggatgagattcctgaggttgcaaataac
gagaaagccgctaaagtggttatcctaaaaaaggcgacagagtgcatccacagcatgcag
ttggatgagcaaaggctgctgtccatcaaagaacagctgaggcgaaagagcgaacagtta
aaacacaggctgcagctgctgcgaagttcacattaa

KEGG   Sinocyclocheilus rhinocerous: 107748305
Entry
107748305         CDS       T04916                                 

Definition
(RefSeq) transcriptional regulator Myc-2 isoform X1
  KO
K04377  Myc proto-oncogene protein
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04110  Cell cycle
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107748305
   04012 ErbB signaling pathway
    107748305
   04310 Wnt signaling pathway
    107748305
   04350 TGF-beta signaling pathway
    107748305
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107748305
   04218 Cellular senescence
    107748305
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107748305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107748305
   03019 Messenger RNA biogenesis [BR:srx03019]
    107748305
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107748305
Messenger RNA biogenesis [BR:srx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107748305
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ NOA36 Usp PAC1
Other DBs
NCBI-GeneID: 107748305
NCBI-ProteinID: XP_016418535
LinkDB
Position
Unknown
AA seq 410 aa
MPVSASLPYKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPPAPSEDIWKKFELLPTPP
LSPSRRQSLSTAEQLEMVSEFLGDDVVSQSFICDADYSQSFIKSIIIQDCMWSGFSAAAK
LEKVVSERLASLHAARKERMMSDSSSNQLNASYLQDLSTSASECIDPSVVFPYPLTESSK
SSKIAPSEPMLVLDTPPNSSSSGGSDSEDDEEEEEEEEEEEEEEEEEEEEEEEEIDVVTV
EKRQKRNEAEVSDSRYPSPLVLKRCHVSTHQHNYAAHPSTRHDQPAVKRLRLEASSSSNN
STSSSNRHGKQRKCTSPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNE
KAAKVVILKKATECIHSMQLDEQSLLSLKEQLRRKSEQLKHRLQQLRSSH
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccggtgagtgcgagtttgccgtataaaaactacgattacgactacgactccatccag
ccctatttctacttcgacaacgacgatgaggatttctatcaccatcagcaaggacagact
caacctccagctcccagcgaggacatttggaagaaattcgagctgctgcccacaccgccc
ctctctcccagccggagacagtcgctctccaccgccgaacagctggagatggtcagcgag
ttcctgggagacgacgtggtcagccagagcttcatctgcgacgcggactactcccagtcc
ttcatcaagtccattatcatccaggactgcatgtggagcggcttttccgccgctgccaag
ttggagaaagtggtttctgagagactggcgtccctgcatgctgctaggaaggaacggatg
atgtctgacagcagctcaaatcaactcaatgcaagttatttgcaggatctgagcacctct
gcatcagaatgcatcgacccctctgtggtctttccgtatcccctcacggagtccagcaaa
tccagcaagattgctccatcggaacccatgcttgtcctggacactccacctaacagctcc
agcagcggtggcagtgattctgaagatgatgaagaagaagaagaggaggaggaggaagaa
gaagaagaagaagaggaggaggaagaagaagaagaggaagaaattgatgtggtgactgtg
gaaaagcgtcagaaaaggaacgaggcggaggtgtcggattcaaggtaccccagtcccctg
gtgttgaagcgctgtcacgtctccacccaccagcacaactacgccgcccacccttccacg
cggcacgaccagccggctgtcaagaggctacgactggaggccagcagcagcagcaacaac
agcaccagcagcagcaacaggcatgggaagcaacgcaagtgcacgagtccccggacatcg
gattctgaggacaatgacaaacgcaggactcacaatgtgctggagcgccaacgtagaaat
gaactcaaactcagctttttcgcactacgggatgagatccctgaggttgcaaataacgag
aaagctgctaaagttgttattctaaagaaggcgacagagtgcatccacagcatgcagttg
gatgagcaaagtttgctgtccctgaaagaacagctgaggcgaaagagcgaacagttaaaa
cacaggctgcagcagctgcggagttcacattaa

DBGET integrated database retrieval system