KEGG   Sinocyclocheilus rhinocerous: 107714673Help
Entry
107714673         CDS       T04916                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107714673
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107714673
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107714673
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107714673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Toxin_4
Motif
Other DBs
NCBI-GeneID: 107714673
NCBI-ProteinID: XP_016376087
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKALILLALFAVAYAAPLDEDDKIVGGFECTKNGVPYQVSLNSGYHFCGGSLITNNWVVS
AAHCYKSSIQVRLGEHNIDVSEGTEQFISSQKIIRHPSYNSNTLDNDIMLIKLASTASLN
GYVQTVSLPSSCASAGSECLISGWGNMSATGSNYPSRLMCLWAPILSDTTCRNAYPGQIT
SNMFCAGFMEGGKDSCQGDSGGPVVCSNRLQGIVSWGYGCAQRNQPGVYTKVCNYVSWIN
TTINSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattcttctggctctgttcgctgtggcttatgctgctcctctggatgag
gatgacaagatcgtcggcggattcgagtgtactaagaatggtgttccataccaggtttcc
ctgaacagtggttaccacttttgcggtggctctctgatcaccaacaactgggttgtgtct
gctgctcactgttacaagtcctctatccaggtgcgtctgggtgagcacaacattgacgtc
tctgagggcaccgagcagttcatcagctcgcaaaagatcatcagacaccccagttacaac
agcaacactctggacaatgacatcatgctgatcaagctggccagcaccgccagtctgaac
ggttacgttcagaccgtctctctgccttcaagctgtgcttcagctggtagcgaatgcctg
atctctggatggggaaacatgagcgccactggaagcaactaccccagccgtctgatgtgc
ctgtgggctcctatcctgagtgacactacctgcagaaatgcctaccctggtcagatcacc
tccaacatgttctgcgctggcttcatggagggtggcaaggactcctgccagggtgactct
ggtggcccagtggtgtgcagcaaccggttgcagggtattgtgtcctggggttacggctgt
gcccagaggaaccaacctggtgtctataccaaggtctgcaactacgtctcctggatcaac
accaccatcaactccaactaa

DBGET integrated database retrieval system