KEGG   Sinocyclocheilus rhinocerous: 107715908
Entry
107715908         CDS       T04916                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04110  Cell cycle
srx04150  mTOR signaling pathway
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
srx04910  Insulin signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107715908
   04310 Wnt signaling pathway
    107715908
   04340 Hedgehog signaling pathway
    107715908
   04150 mTOR signaling pathway
    107715908
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107715908
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107715908
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107715908
   04916 Melanogenesis
    107715908
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107715908
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107715908
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     107715908
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   107715908
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107715908
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 107715908
NCBI-ProteinID: XP_016377652
LinkDB
Position
Unknown
AA seq 425 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGEMVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSKQVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGREK
PALFNFTTQELSSNPSLASILIPAHARNQAGASTPTNASATSDANIGDRSQTTTAASASA
SNTST
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtctggtcggcccagaaccacctccttcgcagagagctgcaagccagtgccgcagccg
tcggcattcggcagcatgaaagtcagcagagataaagatggcagtaaagtgaccacagtg
gtggcgacccctggacagggacctgaccggccgcaggaggtcagctacaccgacaccaag
gtcatcgggaacggctcttttggcgtggtctatcaggccaagctctgtgactcaggagaa
atggtggccattaagaaggtccttcaggacaagcgatttaagaaccgtgagcttcagatc
atgagaaaactggaccactgcaacattgtgcgtctgcgttacttcttctactccagtgga
gataagaaggatgaggtgtatctgaatttggttctggactacgtccctgagaccgtctac
agagtggcgagacactacagccgcgctaagcagacccttcccatggtttatgtgaagttg
tacatgtaccagctcttcaggagtctggcctacatccattcctttgggatctgccatcgg
gacatcaaaccgcagaatcttttgctggacccagacacagccgtgctcaaactctgtgac
tttggcagtgctaagcagttagtacgtggggagcccaatgtttcctacatatgctcacgg
tactacagagcccccgaactcatctttggagcaaccgactacacctctagcatagacgtg
tggtcagctggctgcgtgttggcggaactgttgctaggacaaccaattttccccggcgac
agcggagtggatcagctggtggaaatcatcaaggtgctgggcactcccacacgggagcag
attcgggaaatgaacccaaactacaccgagttcaaattcccgcagattaaggcccaccca
tggactaaggtgagtaaacaggtgtttcggccacgcacgcctcctgaagccattgcgttg
tgctcgcggctgttggagtacaccccgactgctcggctgaccccgctagaggcctgcgct
cactccttctttgatgaactgcgggatcccaatgtcaaacttcctaacgggcgtgagaaa
ccagccttattcaacttcacaactcaagagctgtccagtaacccatccctggcctctatc
ctaattcctgctcatgcacgtaaccaggcaggagcctctacccccaccaacgcctctgcc
acttcagatgccaatattggagatcgcagtcagaccacaactgcagcctctgcctccgcc
tccaacacctcaacctga

KEGG   Sinocyclocheilus rhinocerous: 107721573
Entry
107721573         CDS       T04916                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04110  Cell cycle
srx04150  mTOR signaling pathway
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
srx04910  Insulin signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107721573
   04310 Wnt signaling pathway
    107721573
   04340 Hedgehog signaling pathway
    107721573
   04150 mTOR signaling pathway
    107721573
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107721573
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107721573
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107721573
   04916 Melanogenesis
    107721573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107721573
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107721573
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     107721573
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   107721573
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107721573
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 107721573
NCBI-ProteinID: XP_016385145
LinkDB
Position
Unknown
AA seq 391 aa
DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQD
KRFKNRELQIMRKLDHCNIVRLRYFFYSSGDKKDEVYLNLVLDYVPETVYRVARHYSRAK
QTLPMVYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEII
KVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLT
PLEACAHSFFDELRDPNVKLPNGREKPSLFNFTTQELSSNPSLASILIPAHARNQAGAST
PTNASATSDANSGDRSQTTTAASASTSNTST
NT seq 1178 nt   +upstreamnt  +downstreamnt
gagataaagatggcagcaaagtgaccacagtggtggcgacccctggacagggacctgacc
ggccgcaggaggtcagctacactgacaccaaggtcatcgggaacggctcttttggcgtgg
tctatcaggccaagctctgtgattcaggagaactggtggccattaagaaggtccttcagg
acaagcgatttaagaaccgtgagcttcagatcatgagaaaactggaccactgcaacattg
tgcgtctgcgttatttcttctattccagtggagataagaaagatgaggtgtatctgaatc
tggttctggactacgtccctgagaccgtctacagagtggcgagacactacagccgcgcta
agcagacccttcccatggtttatgtaaagttgtacatgtaccagctcttcaggagtctgg
cctatatccattcctttgggatctgccatcgggacatcaaaccgcagaatcttctgctgg
acccagacacggcggtgctcaaactctgtgactttggcagtgctaagcagttagtacgtg
gggagcccaatgtttcctacatatgctcacggtactacagagcccctgaactcatctttg
gagcaaccgactacacatccagcatagacgtgtggtcagctggctgcgtgttggcggaac
tgttgctaggacaaccaattttccccggcgacagcggagtggatcagctggtggaaatca
tcaaggtgctgggcactcccacacgggagcagattcgagaaatgaacccaaactacaccg
agttcaaattcccgcagattaaggcccacccatggactaaggtgtttcggccacgcacgc
ctcctgaagccattgcgttgtgctcgcggctgttggagtacacgccgactgctcgactga
ccccgctagaggcctgcgctcactccttctttgatgaactgcgggatcccaatgtcaaac
ttcctaatggacgtgagaaaccatccttattcaacttcacaactcaagaactgtccagta
acccatccctggcctcgatcctaattcctgctcatgcacgaaaccaggcaggagcttcta
cccccaccaacgcctctgccacttcagatgccaatagtggagatcgcagtcagaccacaa
ctgcagcctctgcctccacctccaacacctcaacctga

KEGG   Sinocyclocheilus rhinocerous: 107729358
Entry
107729358         CDS       T04916                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta-like isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04110  Cell cycle
srx04150  mTOR signaling pathway
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
srx04910  Insulin signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107729358
   04310 Wnt signaling pathway
    107729358
   04340 Hedgehog signaling pathway
    107729358
   04150 mTOR signaling pathway
    107729358
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107729358
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107729358
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107729358
   04916 Melanogenesis
    107729358
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107729358
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107729358
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     107729358
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   107729358
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107729358
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 107729358
NCBI-ProteinID: XP_016395322
UniProt: A0A673NME4
LinkDB
Position
Unknown
AA seq 419 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVIRDKDGSKVTTVAATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCSTGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVMDYVPENVYRVARHYSRAKQNLPMVYVKLYMYQLFRSLAYIHSYGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDI
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTSRFTPLEACAHTFFDELREPNLKLPNGRERPVLF
NFTTHELSSNPSLASVLIPAHAQNQAENSSQSALAATGANSGDRGPNTNAASAAPNPST
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtcaggccggcctaggaccacctcatttgcggagagctgcaagccagtgccgcagcct
tcagcctttggcagcatgaaagtcatcagagataaagatggcagtaaagttacaacagtg
gccgcgacccccggtcagggacccgaccgacctcaggaggtcagctacacggacacaaag
gtcatcgggaacggctcgtttggggtcgtatatcaagcgaagctgtgcagcaccggagag
ctggtggccataaagaaggtgctgcaggataaaaggtttaagaatcgtgagttacagatc
atgaggaagttggatcactgtaacattgtccgtctgcgctacttcttctactccagtgga
gacaaaaaggatgaggtgtatctgaatttggtgatggactacgtgcctgaaaacgtgtac
cgggtggccagacactacagcagagccaagcagaatctgcccatggtctatgtgaagcta
tacatgtaccagctgttccgcagcttggcgtacatccactcgtatgggatctgccatcga
gacatcaagccgcagaacctcctgctcgacccagagacagctgtactcaaactctgtgac
tttggaagtgctaagcagctggtgcgtggtgagcctaatgtttcctacatctgctcgcgc
tactacagagcccctgagctcattttcggagccacggactacacttccagcatagacatt
tggtcggcgggatgtgtgctggccgagctgctgcttggacagccgatttttcctggtgac
agtggtgtcgatcagctcgttgaaatcatcaaggtgctgggaactcctacacgagagcag
atccgggagatgaacccaaattacactgaattcaagtttccacagataaaggcacacccg
tggactaaggttttccggccccggacccctccggaggcgatagctctgtgttcccgattg
ttggagtacacgcctacgtcccgattcactcctctggaggcctgcgctcacactttcttc
gacgagctccgtgagcccaacctcaagctcccgaatggaagagagcggcctgtgctgttt
aatttcactacacatgagttgtccagtaacccctcgctggcctccgtactcattcctgca
catgctcagaaccaggcggaaaactcttcccagtctgccttggctgcaacaggtgccaac
agtggcgatcgtggtccgaacaccaacgctgcctctgccgcccctaatccttcaacttga

DBGET integrated database retrieval system