KEGG   Sinocyclocheilus rhinocerous: 107715959
Entry
107715959         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04115  p53 signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04218  Cellular senescence
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107715959
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107715959
   04070 Phosphatidylinositol signaling system
    107715959
   04150 mTOR signaling pathway
    107715959
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107715959
  09143 Cell growth and death
   04115 p53 signaling pathway
    107715959
   04218 Cellular senescence
    107715959
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107715959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107715959
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107715959
    3.1.3.48  protein-tyrosine-phosphatase
     107715959
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107715959
Protein phosphatases and associated proteins [BR:srx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107715959
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 107715959
NCBI-ProteinID: XP_016377714
UniProt: A0A673KGG6
LinkDB
Position
Unknown
AA seq 461 aa
MAMTAKIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD
SKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENH
VAAIHCKAGKGRTGVMICAYLLHRRKFLEAQEALDFYGEVRTRDKKGVTIPSQCRYVYYY
SYLLKNKLEYKPIALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGNWHWDPQF
VVYQLKVKIHTSNPAHTRREEKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWI
NTFFIPGPEEAGEKVENGSVVNDVDSLSSQCQSFLAERVREKERGIAVGGFEREKGAERG
GERAGVSVGDKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTS
TSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQHAQITKV
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggcaatgactgcaaaaattaaagaaatagtcagtcggaataagaggcgctaccaagaa
gatgggttcgatttggacttaacgtacatctacccaaatatcattgccatgggattccct
gcagaacggttggagggagtttacagaaacaatatagatgatgtggttcgattcctagat
tcgaagcacaaaaatcattataaaatttataatctatgtgctgaacgacactacgatgca
tccaaattcaattgtagggtggctcaatatcccttcgaggaccataacccgccacagttg
gaattaataaagcccttctgcgaggatcttgaccagtggctgtctgaagacgagaaccac
gtggcggccatccactgcaaggcaggcaaaggtcgcacgggggtcatgatatgcgcctac
ctattgcatcgcaggaagttcttagaggcacaagaggcactggacttttatggggaagtc
aggaccagggataaaaagggggtcaccattcccagccagtgcaggtatgtgtattactac
agctacctgctgaagaacaagctggaatataaacccattgctctcctcttccataaaatg
gttttccagactctgcccatgttcagtgggggcacctgcagggacagtactgttaaaaac
aggagtgaggtgaatccccagggcttcaagaaaggcaactggcactgggaccctcagttc
gtcgtgtatcagttgaaggtaaagatccacacgtcaaacccagcccacacacggagggaa
gaaaagcacatgatctttgagttccctcagcctcttccggtttgtggcgacatcaaagtg
gaattcttccacaaacagagcaagatgatgaagaaggataaaatgttccatttctggata
aacacgttcttcatcccgggtcccgaggaagctggggagaaagtggagaatgggtcggtg
gtcaacgatgtggacagcctctcctctcagtgccagagctttctagcagagagggtgaga
gaaaaggagcgagggatcgcagtgggaggatttgaaagagaaaagggtgcagaaagggga
ggagagcgagcaggagtatcggttggagataaagactacttgattctgaccttaacaaag
aacgacttggataaggccaataaggacaaagctaaccgatatttctcacccaacttcaag
gtgaagttgtacttcaccaagaccgtggaggagccctcaaactcagaagcgagcacttca
acttctgtcactccggatgtgagtgataatgaacccgatcactaccgctattcagacacc
actgattccgacccagaaaatgaaccttttgatgaggaacaacacgcacagattacaaaa
gtctga

KEGG   Sinocyclocheilus rhinocerous: 107716233
Entry
107716233         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04115  p53 signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04218  Cellular senescence
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107716233
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107716233
   04070 Phosphatidylinositol signaling system
    107716233
   04150 mTOR signaling pathway
    107716233
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107716233
  09143 Cell growth and death
   04115 p53 signaling pathway
    107716233
   04218 Cellular senescence
    107716233
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107716233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107716233
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107716233
    3.1.3.48  protein-tyrosine-phosphatase
     107716233
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107716233
Protein phosphatases and associated proteins [BR:srx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107716233
SSDB
Motif
Pfam: PTEN_C2
Other DBs
NCBI-GeneID: 107716233
NCBI-ProteinID: XP_016378106
UniProt: A0A673LIY6
LinkDB
Position
Unknown
AA seq 245 aa
MMSEPKGGVISLSVGFLIINTFLYFLFAQYNAFAYLLFSFSLFKFIPTILLFLPVSLHFS
LSPSLFYQTDPQFVVYQLKVKIHTSNPAHTRREEKHMIFEFPQPLPVCGDIKVEFFHKQS
KMMKKDKMFHFWINTFFIPGPEEAGEKVENGSVVNDVDSLSSQSQSFPAERERGIAAGGL
EREKGAERGGERVGVGDGDKDYLILTLTKNDLDKANKDKANRYFSPNFKVRAHHSTLSNG
SIKVA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgatgtcagagccgaagggtggagttatttcactcagtgtgggcttcttgataattaac
acctttctttatttcctctttgctcaatacaatgcttttgcttaccttttattttctttt
tctctttttaaatttattcccaccattctcctcttcctccctgtctccctccatttctca
ctctctccatctctcttctatcaaacagaccctcagttcgtcgtgtatcagttgaaggta
aagatccacacgtcaaacccagcccacacacggagggaagagaagcacatgatctttgag
ttccctcagcctcttccggtttgtggcgacatcaaagtggaattcttccacaaacagagc
aagatgatgaagaaggataaaatgttccatttctggataaacacgttcttcattccgggt
cccgaggaagctggggagaaagtggagaatgggtcggtggtcaacgacgtggacagcctc
tcctctcagagccagagcttcccggcagagagggagagagggatcgcagcgggaggactt
gaaagagaaaagggtgcagaaaggggaggagagcgagtgggagtaggggatggagataaa
gactacttgattctgaccttaacgaagaacgacttggataaggccaataaggacaaagct
aaccgatacttctcacccaacttcaaggtgagggcacaccattcaacacttagcaatgga
tcgatcaaagtagcttga

KEGG   Sinocyclocheilus rhinocerous: 107724682
Entry
107724682         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04115  p53 signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04218  Cellular senescence
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107724682
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107724682
   04070 Phosphatidylinositol signaling system
    107724682
   04150 mTOR signaling pathway
    107724682
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107724682
  09143 Cell growth and death
   04115 p53 signaling pathway
    107724682
   04218 Cellular senescence
    107724682
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107724682
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107724682
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107724682
    3.1.3.48  protein-tyrosine-phosphatase
     107724682
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107724682
Protein phosphatases and associated proteins [BR:srx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107724682
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 107724682
NCBI-ProteinID: XP_016389180
LinkDB
Position
Unknown
AA seq 431 aa
MAEQETTVAGEHQDRAEGSGNHSSRDGNHGREETLKLRDGTLAMTEQAGMATLGGSVLLC
SFCRFLDLKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKW
LSENDNHVAAIHCKAGKGRTGVMICAYLLHRGKFKKAQEALDFYGEVRTRDKKGVTIPSQ
RRYVYYYSYLLKNKLEYKPVALLFHKMVFETVPMFSGGTCRDSAVKSKSEQIPHGFRKTN
WHWDPQFVVYQLKVKIHTSNPAHTRREEKYMYFDFPQPLPVCGDIKVEFFHKQNKMMKKD
KMFHFWVNTFFIPGPEESSEKVENGGLVKELDGNQTTEHGENDKDYLILTLTKNNLDKAN
KDKANRYFSPNFKVKLYFTKTVEEPSNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPEN
EQYDGEQITKV
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggcagagcaggagaccacagtggctggagagcaccaagacagagctgagggatcaggt
aaccacagcagcagagatggaaatcatggtcgagaagagacattgaaactcagagacggc
actctggccatgacagaacaggcagggatggccaccttgggtggctccgtgttattgtgc
tctttctgcagattcttggatttgaagcataaaaatcattacaagatatataatctatgt
gcggaaagacattatgatactgccaaatttaactgcagagttgcacagtatccgtttgag
gatcacaatcctcctcagttagaacttattaaacctttctgtgaagatttggataagtgg
ctcagtgaaaatgacaatcatgtggctgccattcactgcaaagctggaaagggacgtacg
ggtgtcatgatatgtgcgtacttgttacaccgaggcaaattcaaaaaagcacaagaggct
ctggacttctatggtgaagttagaaccagagacaagaagggagtgactattcccagtcag
aggcgatacgtgtactactatagctaccttctgaagaataagctggagtacaaacctgtg
gccttgctctttcacaagatggtgtttgagacagtgcctatgttcagtggagggacttgc
agggattctgctgtaaaaagcaagagtgagcagattccacatgggttcagaaaaaccaat
tggcattgggatcctcagtttgtggtgtaccagctgaaggtgaaaatccacacgtctaac
ccagcgcacacaaggcgagaggagaagtacatgtactttgattttccacagccactgcct
gtgtgtggagacatcaaggtggagttcttccacaagcagaacaagatgatgaaaaaggat
aagatgtttcacttctgggtgaacaccttcttcatccctggaccagaggagagctcagag
aaggttgaaaatggaggtttagtgaaggaactggatgggaaccaaaccacagaacatgga
gagaatgataaggattatctaatcctgactttaaccaagaacaacttggataaagccaac
aaggataaagccaacagatacttctctccaaacttcaaggtgaagctgtacttcacaaaa
acagtggaggaaccatccaactcagaggccagcacttctacatctgtaaccccggatgtt
agcgataatgaaccggaccactaccggtattcggacacaacagactcggaccctgaaaat
gaacagtatgatggagaacagattactaaagtttga

KEGG   Sinocyclocheilus rhinocerous: 107744570
Entry
107744570         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04115  p53 signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04218  Cellular senescence
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107744570
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107744570
   04070 Phosphatidylinositol signaling system
    107744570
   04150 mTOR signaling pathway
    107744570
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107744570
  09143 Cell growth and death
   04115 p53 signaling pathway
    107744570
   04218 Cellular senescence
    107744570
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107744570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107744570
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107744570
    3.1.3.48  protein-tyrosine-phosphatase
     107744570
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107744570
Protein phosphatases and associated proteins [BR:srx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107744570
SSDB
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase PTEN_C2 DSPn Y_phosphatase2
Other DBs
NCBI-GeneID: 107744570
NCBI-ProteinID: XP_016413775
LinkDB
Position
Unknown
AA seq 247 aa
MAMTAKIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD
SKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENH
VAAIHCKAGKGRTGVMICAYLLHRRKFSEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYY
SYLLKNKLEYKPVALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGNWHWGKTA
LLYYYYC
NT seq 744 nt   +upstreamnt  +downstreamnt
atggcaatgactgcaaaaattaaagaaatagtcagtcggaataagaggcgatatcaagaa
gatgggttcgatttggacttaacttacatataccccaacataattgccatgggcttccct
gccgaaaggttggagggagtctacagaaacaacatagatgatgtggttcgatttctagat
tcgaagcataaaaatcattataaaatttataatctatgtgctgagagacactacgatgca
tccaaattcaattgtagggtggctcaatatcccttcgaggaccataacccgccacagttg
gaattaataaagcccttctgcgaggatctcgaccagtggctgtccgaagacgagaaccac
gtggcggctatccactgcaaggcaggcaaaggccgcacaggggtcatgatatgcgcctac
ctgttgcatcgcaggaagttctcagaggcacaagaggcactggacttttatggggaagtc
aggaccagagataaaaagggggtcaccattcccagccagcgcaggtatgtgtattactac
agctacctgctgaagaacaagctggaatataaacctgttgctctcctgttccataaaatg
gttttccagactctgcccatgttcagtgggggcacctgcagggacagtactgttaaaaac
aggagtgaggtgaatccccagggcttcaagaaaggcaactggcactggggtaaaacggca
ttactttactactactactgttaa

KEGG   Sinocyclocheilus rhinocerous: 107753428
Entry
107753428         CDS       T04916                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04115  p53 signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04218  Cellular senescence
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107753428 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107753428 (pten)
   04070 Phosphatidylinositol signaling system
    107753428 (pten)
   04150 mTOR signaling pathway
    107753428 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107753428 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    107753428 (pten)
   04218 Cellular senescence
    107753428 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107753428 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107753428 (pten)
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107753428 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     107753428 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107753428 (pten)
Protein phosphatases and associated proteins [BR:srx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107753428 (pten)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 107753428
NCBI-ProteinID: XP_016425048
UniProt: A0A673KRA5
LinkDB
Position
Unknown
AA seq 422 aa
MAAIIKEIVSRNKYRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSENDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFKKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNKLEYKPVALLFHKMVFETVPMFSGGTCRDSAVKSKSEQIPHGFRKTNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKYMYFDFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESLEKVENGGLVKERDGIQTTERGENDKDYLILTLTKNNLDKANKDKANRYFS
PNFKVKLYFTKPVEEPSNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEQYDEEQIT
KV
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggctgcgatcataaaggaaattgtcagccgaaacaaatatagataccaggaagatgga
ttcgacttggacttgacctatatttatcctaacattatagcaatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacatagatgatgtagtgcgattcctggattcaaag
cataaaaatcattacaagatatataatctatgtgcggaaagacattatgatactgccaaa
tttaactgcagagttgcacagtatccgtttgaggatcacaatcctcctcagctagaactc
attaaacctttctgtgaagatctggataagtggctcagtgaaaatgacaatcatgtggct
gccattcactgcaaagctggaaagggacgtacgggtgtcatgatatgtgcgtacttgtta
caccgaggcaaattcaaaaaagcacaagaggctctggacttctatggtgaagttagaacc
agagacaagaagggagtgactattcccagtcagaggcgatatgtgtactactatagctac
cttctgaagaataagctggagtacaaaccagtggccttgctgtttcacaagatggtgttt
gagacagtgcctatgttcagtggagggacctgcagggattctgctgtaaaaagcaagagt
gagcagattccgcatgggttcagaaaaaccaattggcattgggatcctcagtttgtggtg
taccagctgaaggtgaaaatccacacgtctaacccagcgcacacaaggcgagaggagaag
tacatgtactttgattttccgcagccgctgcctgtgtgtggagacatcaaggtggagttc
ttccacaagcagaacaagatgatgaaaaaggataagatgtttcacttctgggtgaacacc
ttcttcatccctggaccagaggagagcttggagaaggttgaaaacggaggtttagtgaag
gaacgggatgggatccaaaccacggaacggggagagaatgacaaggattatctaatcctg
actttaaccaagaacaacttggataaagccaacaaggataaagccaacagatacttctct
ccaaacttcaaggtgaagctgtacttcacaaagccagtggaggaaccatccaactcggag
gccagcacttctacatctgtaacaccggatgttagcgataatgaaccggaccattaccgg
tattcggacacaacagactcggacccagaaaatgaacagtatgatgaagaacagattact
aaagtttga

DBGET integrated database retrieval system