KEGG   Sinocyclocheilus rhinocerous: 107719254Help
Entry
107719254         CDS       T04916                                 

Definition
(RefSeq) pancreatic alpha-amylase-like isoform X1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00500  Starch and sucrose metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107719254
Enzymes [BR:srx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107719254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 107719254
NCBI-ProteinID: XP_016382125
LinkDB All DBs
Position
Unknown
AA seq 581 aa AA seqDB search
MKLWVVTEMCPPRVNSRFWKPLDCCLNLLLVEMTGNGSESRSKLSVLNTGCLEKIPHEEK
IPHEPVTRTMKLLIVAALFGLCLAQHNPNTKHNRTSIVHLFEWRWADIAEECERYLAPNG
YGGVQISPPSESIVVTNPWHPWWQRYQPISYNLCSRSGTEEELKDMITRCNNVGVNIYVD
AVINHMCGAAGGEGTHSSCGSYFNANKEGFPSVPYSSWDFNDDKCKTAKEEIENYNDIFQ
VRDCRLVALLDLALEKDYVRGKVAEYLNKLIDLGVAGFRVDACKHMWPGDLTNIYDRLKT
LNTTWFSPGTKPFIYQEVIDLGGEPIKASEYFELGRVTEFKYSAKLGTVIRKWDKEKLSY
LKNWGEGWGFMPSDRAVVFVDNHDNQRGHGAGGASVLTFWDSRLYKIATGLMLAHPYGVT
TVMSSYRWDRHFVNGKDQNDWMGPPSNANGSTKPVPINSDSTCGDKWICEHRWHQIRNMA
IFRNVVNGQPLSNWWDNGNNQIAFSRGSKGFIVINNDDWALNVTLNTGLPMGTYCDVISG
DKSGGTCTGKQVSVGSDGCATFSISNTDEDTFIAIHANSKL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtgggttgtgacagaaatgtgtccgccacgcgtgaactctcgcttctggaag
cctctcgactgctgcctcaatttgttgctcgtagaaatgactggaaacggaagtgagtcg
cgctcaaagctctccgtgctaaacactggctgcttggagaagattccgcacgaagagaag
attccgcacgaacctgttacacgcacaatgaagctcctgattgtggctgcactttttgga
ctgtgtcttgcccagcacaacccaaacactaaacataataggacctccattgttcatctg
tttgagtggcggtgggcagatatcgctgaagaatgtgagagatacctggcaccaaatggc
tacggaggagttcagatctctccccccagcgagagcattgtagtgaccaatccttggcac
ccttggtggcagaggtatcaaccaatcagctacaacttgtgctccagatcaggaactgag
gaagagctgaaggacatgatcacacgctgtaataatgttggggtgaacatatatgtggat
gcagtgattaatcacatgtgtggagccgctggtggagagggcactcactccagctgtgga
tcatacttcaatgccaacaaggagggcttcccctctgttccctactcatcatgggacttc
aatgatgacaaatgtaaaactgccaaagaagagattgaaaactacaatgatattttccag
gtcagggactgtcgcttggtggctctactggatttggccctggagaaggactatgttaga
ggaaaagtagctgaatatctgaacaaactgattgacctgggtgtggctggattcagagtt
gatgcttgtaagcacatgtggcctggtgaccttactaacatctacgacagactcaagact
ctcaataccacttggttttctccaggcaccaagcccttcatttatcaagaggtgatcgac
ttgggtggggagcccattaaagccagtgaatattttgaacttggaagagtgacagaattc
aagtacagtgcgaaactgggcacagtcattcgtaaatgggacaaagaaaagctaagctat
ctcaagaactggggagagggttggggtttcatgccttctgatagagctgtggtgtttgtg
gacaatcatgacaatcagagaggccacggtgctggtggagcttctgttctgacattctgg
gactctaggctttataagatcgctacaggactcatgttggctcatccatacggtgtgacc
acagtcatgtctagctaccgctgggatcgacattttgtgaatggaaaggatcagaatgac
tggatgggccctccaagcaatgccaatggatccactaagccagtacccatcaactcagac
tccacctgtggggacaagtggatctgtgagcacagatggcaccaaatcagaaatatggcg
attttccgtaatgtggtcaatggccagcctctctccaactggtgggacaacggcaataat
cagatagccttcagccgtggcagcaaaggattcattgtcatcaacaatgatgattgggca
ctgaatgtgacgctgaacactggcctgcccatgggtacatactgtgacgtgatctctgga
gacaagagtgggggcacttgcacaggaaaacaggtgtcagtgggttctgatggatgtgcc
acctttagcatcagcaacacagacgaggatacattcattgccatccatgctaactccaaa
ctgtag

DBGET integrated database retrieval system