KEGG   Sinocyclocheilus rhinocerous: 107719868
Entry
107719868         CDS       T04916                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107719868
   04068 FoxO signaling pathway
    107719868
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107719868
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107719868
NCBI-ProteinID: XP_016382894
UniProt: A0A673HAE5
LinkDB
Position
Unknown
AA seq 176 aa
MGISFLCPRNMSLTPDACYFGLLEGQEEDIKPQAAVVRRNLFGPVDHQQLQQDFQRLFCM
NVEIAKQRWNFDFQRDQPVPGCIEWEELQCQDVPVFYHSCVVRPGMAKQTTVEACSSPAM
ATEKYLELRTRGTLRGTKSEKRMAALLGVKHTQANITDFFRVTKRRFPDHKASSGQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atgggcatttctttcctttgtcccaggaacatgtccttgacaccagatgcatgttatttt
gggttgctggaagggcaggaggaggacattaagcctcaggcagcagtggttcggcggaac
ttgtttggcccagtggaccaccagcagttgcagcaggacttccagaggctattctgcatg
aatgttgagatcgccaaacagcgctggaactttgactttcagagggaccagccagtcccc
ggctgcattgagtgggaggagctgcagtgccaggatgtgccagtgttctaccatagctgt
gtggtcaggcctggtatggcaaagcaaacaacagtggaagcttgttcgtctccagctatg
gccacagagaaatatctggagctgcggaccagaggaactttgaggggaaccaagtcagag
aagagaatggctgcattgctgggggtcaaacacacacaagcaaacatcacagactttttc
agagtgacaaaaagaaggtttccagatcacaaagcttcatcaggacagtaa

DBGET integrated database retrieval system