KEGG   Sinocyclocheilus rhinocerous: 107720436Help
Entry
107720436         CDS       T04916                                 

Definition
(RefSeq) sialidase-4-like
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00511  Other glycan degradation
srx00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107720436
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107720436
Enzymes [BR:srx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     107720436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 107720436
NCBI-ProteinID: XP_016383617
LinkDB All DBs
Position
Unknown
AA seq 433 aa AA seqDB search
MGSQYFPARSVLFQKEPSGVTYRVPALIYMPRSSCFLVFCEERLTPADAQAHLLVMRKGT
FYKNYVEWKDMEVLSTARLEGYRSMNPCPVYDEFTGTVFLFFIAVLGHTSESYQLITGKN
VTRLCYVSSSDQGDTWSSVTDLTRTLIGDTIKEWATFAVGPGHGTQLKSGRLIIPAYAYH
IDCRNCFGRKCKTSSHSFCFYSDTHGKAWHFGEALSAPESVECQMVSVDEENGVNFLYCN
ARSVSGCRVQAVSFDNGAVFHNGQLVYKLVEPKNGCHGSVIGFPAPIYELGQSQHFLRQL
RSIYTPRAVSMSPPNFLPPTWVIYTHPTCSKARRDLGVYLSLLPRDPDSWSGPWIIYAGP
SAYSDLAYVEMSTDAPAVPVFACLFENGTKTAYNEISFCIFTLYELIDHLPHNNQKRKGF
RKRKGLWECCFVC
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcaatacttcccagcacgatccgtgcttttccaaaaggagccgagtggagtt
acataccgtgtgcctgctttgatctacatgcctcgttccagctgtttcttggtcttctgt
gaggagagactgactccggcagacgctcaagcacatctgctggtcatgcgcaaaggcact
ttttataaaaactatgttgaatggaaagacatggaggtgttgagtacagctcgactggag
ggctaccgctcaatgaacccctgccccgtttacgatgagtttactggcacagtcttcttg
tttttcattgctgttctgggtcacacctctgagtcttaccagttaattacaggaaagaac
gtgacacgtctttgctatgtgtccagcagtgaccaaggggacacctggagctctgttaca
gaccttaccaggacgctcataggggacaccattaaagagtgggccacttttgctgtgggt
ccaggtcacggaacccaattaaaatctggaaggctaataatccctgcttatgcctaccat
attgactgcagaaattgctttggcaggaagtgcaagacttcgtcacactcgttttgtttt
tatagtgacacgcatggaaaagcgtggcattttggagaggcgttgtccgcgccagagagt
gtggagtgtcagatggtgtcagtagacgaggaaaatggagtcaactttttgtactgcaat
gcccggagtgtatcaggttgccgtgtgcaagctgttagctttgataatggggctgttttt
cacaatggccagctggtgtataaactagtggagccaaagaatgggtgccatggcagtgta
attggatttccagcaccaatctatgagctcgggcaatcccaacactttctgagacagttg
aggtccatctacaccccacgtgcagtcagcatgtcaccaccgaacttccttccaccaaca
tgggtgatatatactcaccccacctgctcaaaagcccgtcgtgacctcggtgtttacctc
agtcttctgcctcgagacccagacagctggtcaggaccttggatcatatatgcaggcccg
agtgcatattcagacttggcctatgttgagatgtctactgatgccccagcggtccctgtc
tttgcctgcctttttgagaacggcacaaagacagcttataatgagatttccttctgcatc
ttcacactgtatgagctaatcgaccaccttccccacaacaaccaaaaaagaaaagggttc
agaaagaggaaaggattgtgggagtgctgctttgtctgctga

DBGET integrated database retrieval system