KEGG   Sinocyclocheilus rhinocerous: 107720711
Entry
107720711         CDS       T04916                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11-like
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04114  Oocyte meiosis
srx04120  Ubiquitin mediated proteolysis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107720711
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107720711
   04340 Hedgehog signaling pathway
    107720711
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107720711
   04218 Cellular senescence
    107720711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:srx04121]
    107720711
   03036 Chromosome and associated proteins [BR:srx03036]
    107720711
Ubiquitin system [BR:srx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107720711
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107720711
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 107720711
NCBI-ProteinID: XP_016384000
LinkDB
Position
Unknown
AA seq 524 aa
MEPEMEDKTLELMNFSIMDSQPADRSPKITVIKVSNGPLTGSRKRPSEGNYEKEKDVCIQ
LFDQWSEADQVEFVEHLISHMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSF
LDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTTE
VPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLR
DNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIH
HNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS
ASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRV
LEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRL
QFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSPSRTYTYISR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaaaccttagagctgatgaacttctctatcatggactcg
cagcctgcagaccgatccccaaagatcacagtgattaaggtgagtaatggacctttgaca
ggctctaggaagcggccgtcagagggaaattatgagaaggagaaggacgtgtgcatccag
ctctttgatcagtggtctgaggcagaccaggtggagtttgtggaacacctgatctcacac
atgtgccattaccaacacggccacataaactcctacctcaaacccatgctccaaagggac
ttcattacggcactgccagctcagggtctggaccatatagcggagaacatcttgtccttc
ctggacgcacgctcgctttgttcagctgagctggtgtgtaaagaatggcagcgtgtgata
tccgaaggcatgttgtggaagaagctgatcgagaggatggttcggacagacccgttgtgg
aagggcctttcagagagacaccagtgggaaaaatacctgttcaagaaccgcacaacagaa
gttcctccaaactcatactaccgctctctttatccaaaaatcattcaggacattgagacc
atcgaggcaaactggaggtgtggccgacataacctgcagaggatccagtgtagatcggag
aacagcaaaggtgtttactgtctccagtatgacgacgaaaagatcatcagcggtctacgc
gataactccatcaagatatgggataaacagactctggagtgtttgaagattctgacggga
cacacaggctctgtgctgtgtctgcaatacgatgagagagtcattgttaccggctcctct
gattccactgtcagagtgtgggatgtgaactcgggggaggttctgaacactctgatccac
cacaacgaggccgtgctccacctgcgattctgtaatgggctgatggtcacctgctcgaag
gatcgctccattgccgtgtgggacatggcctctcctacggacatcagtctccgccgggtc
ctcgtcggacacagggctgccgtcaatgtggtcgactttgacgacaagtacattgtctct
gcctctggggatcggaccataaaggtgtggagtacaagcacctgtgagtttgttcggaca
ctaaacggtcataagcgaggaattgcctgcctgcagtacagagacagactcgtggtcagc
ggctcctcagacaacaccatcaggctgtgggatatagagtgtggagcttgtttgcgggtt
ttggaaggccacgaggagcttgttcgctgtattcgctttgataacaagcggatcgtgagt
ggagcgtatgacggtaaaattaaagtatgggacctacaagctgctctcgatccacgagcc
ccagccagcactctgtgtctacgtacactagtggaacattctggccgagtgttccggctg
cagtttgacgagttccagatcatcagcagttcccacgatgacactatccttatctgggac
ttcctcaacgtgtcgaccaatgggcagacggaaggacgatcgccgtcccgcacgtatacc
tatatatccagatag

KEGG   Sinocyclocheilus rhinocerous: 107742374
Entry
107742374         CDS       T04916                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11-like isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04114  Oocyte meiosis
srx04120  Ubiquitin mediated proteolysis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107742374
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107742374
   04340 Hedgehog signaling pathway
    107742374
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107742374
   04218 Cellular senescence
    107742374
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:srx04121]
    107742374
   03036 Chromosome and associated proteins [BR:srx03036]
    107742374
Ubiquitin system [BR:srx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107742374
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107742374
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 F-box_4 DUF1513 DUF4508 WD40_2
Other DBs
NCBI-GeneID: 107742374
NCBI-ProteinID: XP_016410809
LinkDB
Position
Unknown
AA seq 454 aa
MEPEMEDKTLELMNISVMDSQTADRSPKITVIKPTFICPQVSNGPLTGSRKRPSEGNYEK
EKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHI
AENILSFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYL
FKNRTTEVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDE
KIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGE
VLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDF
DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIE
CGACLRVLEGHEELVRCIRFDNKRIVSGAYDGYA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaaaccttagagctgatgaacatctctgtcatggactcg
cagactgcagaccgctccccaaagatcacagtgattaagcctacttttatctgtcctcag
gtgagtaatggacccttgacaggctctaggaagcggccgtcagagggaaattacgagaag
gagaaggacgtgtgcatccagctctttgatcagtggtctgaggcggaccaggtggagttt
gtggaacacctgatctcacgaatgtgccattaccaacatggccacataaactcctacctc
aaacccatgctccaaagggacttcattacggcactgccagctcagggtctggatcatata
gcggagaacatcttgtccttcctggacgcacgctcgctttgttcggctgagctggtgtgt
aaagaatggcagcgtgtgatatccgaaggcatgttgtggaagaagctgatcgagaggatg
gttcggacagacccactgtggaagggcctttcagagagacaccagtgggaaaaatacctg
ttcaagaaccgcacaacagaagttcctccaaactcatactaccgctctctttatccaaaa
atcattcaggacattgagaccatcgaggcaaactggaggtgtggccgacataacctgcag
aggatccaatgtaggtcggagaacagcaaaggtgtttactgtctccagtatgatgacgaa
aagatcatcagcggtctacgcgataactccatcaagatatgggataaacagactctggag
tgtttgaagatccttacggggcacacaggctctgtgctgtgtctgcaatacgatgagaga
gtcattgttaccggctcctctgattccactgtcagagtgtgggatgtgaactcgggggag
gttctgaacactttgatccatcataacgaggctgtgctccacctgcgattctgtaacggg
ctgatggtcacctgctcgaaggatcgctccatcgccgtgtgggacatggcctctcctact
gacatcagtctccgccgggtccttgtcggacaccgggctgccgtcaatgtggtcgacttt
gacgacaagtacattgtctctgcctctggggatcggaccataaaggtgtggagtacaagc
acctgtgagtttgttcggacactaaatggtcataagcgaggaattgcctgcctgcagtac
agagacagacttgtggtcagcggctcctcagacaacaccatcaggctgtgggatattgag
tgtggagcttgcttgcgggttttggaagggcacgaggaacttgttcgctgtattcgcttt
gataacaagcggatcgtgagtggagcgtatgacgggtacgcctga

KEGG   Sinocyclocheilus rhinocerous: 107747095
Entry
107747095         CDS       T04916                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11-like isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04114  Oocyte meiosis
srx04120  Ubiquitin mediated proteolysis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107747095
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107747095
   04340 Hedgehog signaling pathway
    107747095
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107747095
   04218 Cellular senescence
    107747095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:srx04121]
    107747095
   03036 Chromosome and associated proteins [BR:srx03036]
    107747095
Ubiquitin system [BR:srx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107747095
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107747095
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160
Other DBs
NCBI-GeneID: 107747095
NCBI-ProteinID: XP_016417007
LinkDB
Position
Unknown
AA seq 562 aa
MDPDMEDKTLELMCSLPRSVWLGCSSVAESLCALRCLQSLPSSRAHNQSMTLMESQNNTD
DVSPKKTTVFKFGNGSVAGLRKRTSQGNFEKEKDLCIQLFDQWSESDQVEFVEHLISRMC
HYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDAHSLCSAELVCREWQRVISD
GMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTNEVPPNSYYHSLYPTIIQDIETIE
ANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKVLTGHT
GSVLCLQYDDRVIVTGSSDSTVRVWDGVSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDR
SIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLN
GHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGA
YDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFL
NVSTNGQPERRSPSRTYTYVSR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggatccggacatggaggacaaaaccctggagctgatgtgttctttgcctcgttctgtc
tggctgggttgttcgtcggtggcagagagtctgtgtgctctcagatgcctgcagagcctc
ccgtcctcccgggcccacaaccagagcatgacgttgatggagtcacaaaataacaccgat
gacgtctcaccaaagaagacaacagtgtttaagttcgggaacggttcagtggcaggtttg
aggaagaggacgtcacaggggaatttcgagaaagagaaagatctgtgcatccagctgttt
gatcagtggtcagaatcggatcaggtggagtttgtggagcatctgatttctcgcatgtgt
cactaccagcacggccatataaactcataccttaaacccatgttacagagagacttcatc
accgcgttgccagctcagggtctggatcacatagcggagaacatcctctcgtttctcgat
gctcattctctgtgctctgctgagctggtctgtcgagaatggcagcgggtaatttcagac
gggatgctctggaagaagctcatcgagaggatggtgcgcacagacccgctgtggaaaggc
ctgtcagagcgtcatcagtgggagaaatatttatttaagaaccgaacaaacgaggttccg
cccaattcatactaccattcactctatcccacaattatacaggacatcgagactattgaa
gcgaactggcgttgtggacgtcacaatcttcagcggattcagtgccggtcggagaacagt
aaaggtgtttactgccttcagtatgacgacgacaagatcatcagcggcctgcgagacaac
tccatcaaaatctgggacaaacagtctctggagtgtctgaaggtcctgacgggtcacact
ggttcggttctgtgtctgcagtacgatgacagagtcatagtgacgggctcctctgattct
actgtcagggtgtgggacggtgtttctggtgaggttctcaacactctgatccatcacaac
gaggctgttctgcacctgcgcttctgtaacggtctcatggtgacctgttcgaaagatcgc
tccatcgccgtgtgggacatggcgtctgcaaccgacatcagcctgcgccgtgtgctagtg
ggtcaccgcgccgccgttaacgtggtggactttgacgacaaatacattgtgtctgcgtct
ggagacagaaccataaaagtgtggagcaccagcacgtgtgagtttgtacggacgcttaac
ggtcacaagcgcggcatcgcctgccttcagtacagagacagacttgtggtcagcggatcc
tcagacaacaccatcagactgtgggacattgagtgtggtgcttgtctgcgtgtgctggag
ggacatgaggagcttgtgcgctgcatcagattcgacaacaagaggatcgtgagcggagca
tatgatgggaaaattaaagtttgggatttacaggcagctctggatcctcgggcccctgcc
agcacgttatgtctgcgtacacttgtggagcattctgggcgtgtgttccgactgcagttt
gatgagttccagattattagcagttcccatgacgacacgatccttatatgggacttcctg
aatgtctccaccaatggccagccggagaggcgatcgccctcgcggacatatacatacgtc
tccagatag

KEGG   Sinocyclocheilus rhinocerous: 107754486
Entry
107754486         CDS       T04916                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04114  Oocyte meiosis
srx04120  Ubiquitin mediated proteolysis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107754486
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107754486
   04340 Hedgehog signaling pathway
    107754486
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107754486
   04218 Cellular senescence
    107754486
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:srx04121]
    107754486
   03036 Chromosome and associated proteins [BR:srx03036]
    107754486
Ubiquitin system [BR:srx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107754486
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107754486
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160
Other DBs
NCBI-GeneID: 107754486
NCBI-ProteinID: XP_016426435
UniProt: A0A673KSR6
LinkDB
Position
Unknown
AA seq 562 aa
MDPDMEDKTLELMCSLPRSVWLGCSSVAESLCALRCVQSLPSSRAHNQSMTVLESQNNTG
DVSPKKTTVFKFGNGSVAGSRKRLSQGNFEKEKDLCIQLFDQWSESDQVEFVEHLISRMC
HYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCREWQRVISD
GMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTNEVPPNSYYHSLYPKIIQDIETIE
ANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKVLTGHT
GSVLCLQYDDRVIVTGSSDSTVRVWDVVSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDR
SIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLN
GHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGA
YDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFL
NVSTNGQPERRSPSRTYTYVSR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggatccggacatggaggacaaaaccctggagctgatgtgttctttgcctcgttctgtc
tggctgggttgttcgtcggtggcagagagtctgtgtgctctcagatgcgtgcagagcctc
ccgtcttcccgggcccacaaccagagcatgacggtgttggagtcacagaataacacaggt
gacgtctcaccaaagaagacaacagtgttcaagttcgggaatggttcagtagcgggttcg
aggaagaggttgtcacaggggaacttcgagaaggagaaagatctgtgcatccagctgttt
gatcagtggtccgaatcggatcaggtggagtttgtggagcatctgatctcacgcatgtgt
cactaccagcacggccatataaactcctaccttaaacccatgttacagagagacttcatc
accgcgttgccagctcagggtctggatcacatagcggagaacatcctctcgtttctcgat
gctcgttctctgtgctctgctgagctggtctgtcgagaatggcagcgggtcatttcagac
gggatgctctggaagaagctcatcgagaggatggtacgcacagacccgctgtggaaaggc
ctgtcagagcgccaccagtgggagaaatatttatttaagaaccgaacaaacgaggttccg
cccaattcatactaccattcactctatcccaaaattatacaagacattgagactattgaa
gcgaactggcgttgtggacgtcacaatctccagcggattcagtgccgttcagagaacagt
aaaggtgtttactgccttcagtacgacgacgacaagatcatcagcggcctgcgagacaac
tccatcaaaatctgggacaaacagtctctggagtgtctgaaggtcctgacgggtcacact
ggttcggttctgtgtctgcagtacgatgacagagtcatagtgacgggctcctctgattct
actgtcagggtgtgggatgttgtttctggtgaggttctcaacactctgatccatcacaac
gaggcggttctgcacctgcgcttctgtaatggtctcatggtgacgtgttcaaaagatcgc
tccatcgcggtgtgggacatggcgtctgcgaccgacatcagcctgcgccgcgtgctcgtg
ggtcaccgcgccgccgtcaacgtggtggacttcgatgacaaatacatcgtgtctgcgtct
ggagacagaaccataaaagtgtggagcacaagcacgtgtgagtttgtacggacgcttaat
ggtcacaagcgtggcatcgcttgccttcagtacagagacagactcgtggtcagcgggtcc
tcggacaacaccatcagactgtgggacattgagtgtggtgcttgtctgcgtgtgctggag
ggtcatgaggagcttgtgcgctgcatcagattcgacaacaagaggatcgtgagcggagca
tatgatgggaaaattaaagtttgggatttacaggcagctctggatcctcgggccccagcc
agcacgttatgtctgcgtacactcgtggagcattctgggcgtgtgttccgactgcagttt
gatgagttccagattattagcagttcccatgacgacacgatccttatatgggacttcctg
aacgtctccaccaatggccagccagagaggcgttcgccctcacggacatatacatacgtc
tccagatag

DBGET integrated database retrieval system