KEGG   Sinocyclocheilus rhinocerous: 107721172
Entry
107721172         CDS       T04916                                 

Definition
(RefSeq) protransforming growth factor alpha-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107721172
   04012 ErbB signaling pathway
    107721172
SSDB
Motif
Pfam: Mucin SSP160 Laminin_EGF PepSY_TM FSA_C EGF DUF4834 DUF3439 CBP30
Other DBs
NCBI-GeneID: 107721172
NCBI-ProteinID: XP_016384531
LinkDB
Position
Unknown
AA seq 215 aa
MLLFRCFLIAVTVMSLAIFDFVGSSFSHLGSLFTYGQVQENSTSTTTIATTTTTTTTTTT
TTTTSTTTTTTTSHVKKFIAAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHPGF
MGMRCEHADLLAVVASNHRQQTVATMLVLCVVGSVVLMLLCTLLNCWWRRGGCGRGNTIS
CWSEKPRSILTGGTSCCHSETGILVLYFHFYTTFC
NT seq 648 nt   +upstreamnt  +downstreamnt
atgctgttgttccgctgttttctcattgctgtaacggtcatgagtctggcaatttttgac
tttgttggatcctcattttcacatttgggatccctttttacatatgggcaggtgcaagag
aattctacctcaacaacaaccattgcaaccaccacaacaacaactaccaccactaccaca
acaaccaccaccagcacgaccacaaccactactacttcacatgtcaaaaaatttatagca
gccgctgtccactctcacttcgatgactgccctgactcccatagccacttctgttttcat
ggcacatgccgctttctcatactggaggaaacacctgcatgtgtatgtcatcctggcttt
atgggtatgcgatgtgaacatgcagacctcttggcagtggtggcgtctaaccacaggcaa
cagactgtggccaccatgctggtgttgtgtgtggtgggcagtgttgtactcatgctgctg
tgcacgttactaaattgttggtggagacggggtggttgtgggcgaggtaacaccatttcg
tgttggtcggagaagcctaggagtattctgactggtgggacatcctgctgtcactcagaa
acaggtattctggtgctatatttccatttttacacaactttttgctga

DBGET integrated database retrieval system