KEGG   Sinocyclocheilus rhinocerous: 107721790Help
Entry
107721790         CDS       T04916                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx03030  DNA replication
srx03410  Base excision repair
srx03420  Nucleotide excision repair
srx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107721790 (lig1)
   03410 Base excision repair
    107721790 (lig1)
   03420 Nucleotide excision repair
    107721790 (lig1)
   03430 Mismatch repair
    107721790 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:srx03032]
    107721790 (lig1)
   03400 DNA repair and recombination proteins [BR:srx03400]
    107721790 (lig1)
Enzymes [BR:srx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107721790 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     107721790 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107721790 (lig1)
DNA replication proteins [BR:srx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107721790 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107721790 (lig1)
DNA repair and recombination proteins [BR:srx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107721790 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     107721790 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     107721790 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 107721790
NCBI-ProteinID: XP_016385441
LinkDB All DBs
Position
Unknown
AA seq 977 aa AA seqDB search
MQRSIASFFQPMKSKEKSDGQVKAKTEPVKSPLKIQNGMQENDSPVKKVHKRSRAIIDSD
DEDQPIVKEQVPKQSEVQTAKPEKAASTVSPKTPITPTTPVTSSTSVAVVTPASSGTPGT
PTSASPSGIPKRKTARKHFPKRKLESRSDGEGTKEEENEVDGAQESKRARVESSPGKTDN
EMMEVEEKRADGKTVVEEQKGEDKAKSTVVEDDANNEMKEKDKSDIKQEKKINGENGKKE
KKEGKKEKEDSSPERVVKKEKNTEEEGGSAKKKPISSFFAPRKAAVKLEKEEQIEGEKKK
NGEISDAAEQKEKKSEKGMDSAVQSQYDPSRAHYNPVDHACWQKGQKVPYLAVARTFEKI
EEDSGRLKNIETLSNFLRSVILFSPDDLLCCVYLCLNQLGPAYQGLELGVGETVLMKAVA
QATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNKLKEIANMSGNSA
MNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSALSQAVCLSPPGQEFPPA
VLDAGKGMSAENKRVWMEEKALILKQTYCEMPNYDAIIPVLLKEGIDQLPNHCKLTPGVP
LRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTSKYP
DIISRIPQVKKENVRSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKVQVCVYA
FDLLYLNGKSLVREPLSKRKALLRESFEEKEGEFVFARSLDADNTEAIAEFLEQSVRDSC
EGLMVKTLEKHATYEIAKRSHNWLKLKKDYLEAVGDTVDLCVIGAYLGKGKRAGSYGGFL
LACYDEENEEFQSVCKIGTGFKDEDLEQHYNFLKEHILPKPRPYYRVDQSAEPDVWLEAV
QVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRYLRIRDDKKPEDATTGSQIADLYKK
QQQIQNQGKKQDLEDYY
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatagcatctttctttcagccaatgaaaagcaaggaaaagagtgatgga
caggtcaaagcaaaaaccgaacctgtaaaaagtcctctcaaaattcagaatggcatgcag
gaaaatgattcacctgtaaagaaggttcataaacgcagtcgagcaatcatagacagtgat
gatgaagatcagccaatagtaaaagagcaggtgccaaaacagagtgaagttcaaacagca
aagccagagaaggctgcttccactgtatctccaaaaactcccataaccccaacgactcct
gtcacgtcgagtacctctgttgccgtggtaacccctgcttcctcaggtactccaggaact
ccgacatcagcatcgccgtcaggcattcccaaacgcaagactgcccgcaagcatttcccc
aagaggaagctggaaagcagaagtgatggagaggggacaaaagaggaggagaatgaggtc
gatggagcgcaggaaagtaagagagcacgagtagagtcttcacctggaaagacagacaac
gagatgatggaggtggaagagaagagagcagatgggaagactgttgtggaggaacagaaa
ggggaggataaagcaaaatcaaccgtagttgaggacgatgcaaacaatgagatgaaagaa
aaggataaaagtgacataaaacaggagaaaaagataaatggagaaaatgggaagaaagaa
aaaaaagaaggcaagaaagagaaggaagatagcagtcctgaacgagtggttaaaaaagaa
aaaaacacagaagaggaagggggatcggccaaaaagaaacctatcagcagcttttttgct
cccagaaaggcagctgtaaaactggaaaaagaggagcaaattgagggagaaaaaaagaag
aatggagagatctctgatgctgctgaacagaaagagaagaaaagtgaaaaggggatggat
tctgcagtccagagccagtatgatccctccagagcacattacaatcccgttgaccacgct
tgctggcagaagggccaaaaagtgccatatttggctgtcgctcgcacctttgagaagatt
gaagaggattcgggcaggctgaagaacattgaaacgctttccaactttctgcgatctgta
attctgttctctcccgatgacctgctatgctgtgtgtacctgtgtctgaatcagctcggc
cctgcatatcagggtctggagctgggtgttggggagaccgtcctgatgaaagccgtcgct
caagcaactgggcgacaactggacaaaatcaaggcggaggctcaggagaaaggtgacctg
ggattggttgctgaaagttcccgtagcaaccagagaatgatgtttgcaccggccaatctg
acagcagggggcgttttcaacaaactgaaagagattgctaacatgagtggaaactctgca
atgaataagaagattgacattattaaaggcctctttgtggcatgtcggttttctgaggct
cgatacattgtcaggtcactggctgggaagctgcggatcggattggctgagcagagcgtt
ctctcggctctcagtcaggctgtgtgtctgtcgcccccgggccaagagttcccaccggct
gtgctggatgcagggaaaggaatgagtgcagaaaacaagagagtgtggatggaagagaaa
gcactgatcctgaaacagacatactgtgagatgccaaattatgatgctatcattcctgta
ttgctgaaggagggcatagatcaactgcccaatcactgcaagctcaccccaggtgttccc
ctgcggcccatgttggctcacccgactaaaggggtcggtgaggtaatgaaacgttttgat
gaggcatctttcacctgcgagtataaatacgatggagagagagcccagatccatattctt
gagaatggagaggtgcgcatttttagccgaaaccaagaggacaacacaagcaaataccct
gatattatttcacgaatcccacaggtgaagaaagagaacgtacggtcctgtgttctggat
tcagaggcggtggcctgggacagagaaaagaaacagatccagccgtttcaggtcctcacc
acgaggaagaggaaggatgtggatgcatctgagatcaaggttcaggtgtgtgtgtacgcc
tttgatctgctgtacctcaacggaaagtctctggtgcgagagcctctaagcaaacgcaag
gctctgttacgggagagttttgaggaaaaagaaggggagtttgtttttgctcgatctctg
gacgctgacaacacggaggccatcgctgagtttctggagcagtctgtacgagattcttgt
gagggcctaatggtgaagacattggaaaagcatgcaacttatgagattgccaagcgctcc
cacaactggctcaagctgaagaaggactatctggaggctgttggagacacagtggatctg
tgcgtgattggtgcttatctggggaaggggaagagagcaggcagctatggaggatttcta
ctggcctgctacgatgaggagaacgaggagttccagtctgtctgcaagattggaacaggc
ttcaaagatgaagatctggagcaacattacaattttttaaaggagcacatcttgcctaaa
ccacgcccatattaccgtgtggaccaatcggcagagccggatgtctggctggaggcggta
caagtgtgggaggtgaaatgcgctgacctttcactgtctccagtctacaaggcagcaatg
ggattggtggacccagagaaaggcatttcactccgtttcccacggtacctcaggattaga
gatgacaaaaaaccagaggatgccaccacagggtcacagattgcagatctctacaagaag
cagcagcagattcaaaaccagggcaaaaaacaagatctggaagactactattga

DBGET integrated database retrieval system