KEGG   Sinocyclocheilus rhinocerous: 107722920
Entry
107722920         CDS       T04916                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107722920
   04068 FoxO signaling pathway
    107722920
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107722920
   04115 p53 signaling pathway
    107722920
   04218 Cellular senescence
    107722920
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107722920
NCBI-ProteinID: XP_016386906
LinkDB
Position
Unknown
AA seq 154 aa
MCFLMQLEVMAMHKRILWALGNGAARRTLFGPVDREQLQLEYRDALRRDLEEASRRWGFD
FATETPLVGGDFQWEGVSGVKVPVLYRAGQEEHPSRSGVGKENVPRTPKRYSVLPQNVEK
TPEKRTELKRKQTNITDFYLAKKRGVATPHKSGQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtgttttctgatgcagcttgaggtgatggcgatgcacaagcggatcctgtgggctctc
gggaacggcgcggcgcggcggaccctcttcggtccggtggatcgcgagcagctccagctg
gagtaccgcgatgctctgaggagagacctagaggaggcgtctcgccgctggggcttcgac
ttcgccactgagacgcctcttgtgggcggagacttccagtgggagggcgtgtctggggtc
aaggtgcccgtcttgtaccgcgccggtcaggaggagcatccgtcgaggtccggcgtgggg
aaagagaacgtccccagaaccccgaagagatacagcgttctcccgcagaacgtggagaaa
acgccagaaaagaggaccgagctgaagaggaaacagaccaatatcacagatttctacctg
gcgaagaagagaggggtggctacaccccacaaatcaggacaataa

DBGET integrated database retrieval system