KEGG   Sinocyclocheilus rhinocerous: 107724106Help
Entry
107724106         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-A-like isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107724106
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107724106
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107724106
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107724106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET TUDOR_5 Tudor_4 MBD DUF5604
Motif
Other DBs
NCBI-GeneID: 107724106
NCBI-ProteinID: XP_016388377
LinkDB All DBs
Position
Unknown
AA seq 1589 aa AA seqDB search
MSSRKDDDNLLRMTKDDLQRWIQAEVDRNPHLMQRREQLAQVEDWVKQKEREATYTHLLY
SNACESVHECESVMKGLYGMLGLEYRDEDSEEEGGGEPQDVIHITDDEEDKQDNSVLNGD
DDDIVVIDLGATKETLEPMLEKVTVAIQKSSRLVQDLVQMVNKTSSMSAASPSSSSDVSN
RPSSALTFETSRSESVTPKLEIPENPIAKVKTESLPKVPEMPSLLSNSEQYKPIAGYKSD
SKLTIKTEPQLTALTPWEMSISKQHETSATLNSPSLKLIKTEPQLTAVSPSETPETFARP
HFGSIATIKTEPQSTVIKSEMTSPPSTSKPFKIASIASIKTEPQLRALTPEMSLLERDSE
KSSSLRSDHEAASNTERTLPAMTYEILKTSACPYSASVASKKTEPQVSLVTPSEMSSPSS
SSEQMETAASDNTANVETNQTEPESTTETPPELASLRSNSEEAETNASHDSDSTDETEQP
KPRSKPDNPSVTETSPTTRLRSSKNNAPLSSTSSPQTEAKSAQTPADSNDELSDTEDLSV
SPADSDYEPPESESLSDSDYEPPKSQSKSSRNSDFEPPKSQSESSRNNDFEPPKSQLESS
RNNDFEPPKSQSESSRDSDYGPPKSQSESSRDSDYGPPKSQSQSSVDNTDDASSSDASAE
PSSPDGSYKSSSSESSKQQEHKEIKLNVGMVVLGKRAHNLWRKGTVQEVQTEEDGLRYKV
ESKSGKEIVLPAYRVASLQPPILKDLFIGCRVVASSIDDEGKASFNAAVLVELPERKNRM
RFLVFFDDGHAAYLALPDLHIVCKQLKKVWKDIEDEKLQLQVKEYLRVYPNPIAVVLRAG
QDTKAIRNGKFETCTVLQLDGSLIQICFKKDKQKEWIYKGSDRLEHIVNIKQRLAKDKPQ
KKPLQKTQHKPQQPSQQKAQQQQPQQKAQQAVQQKPQQPSQQKTQQPAISAGNATPQHNT
TPSSTAVPPATVTSTTVISTAVSPVRVTRQSDTVIKTSSVSPQNIMSAAFQPKVILQRLT
MLSPVVRAVSNLRSAKRPAPDEEEECFSEEEDCVSMQHQYKSIYLHHRCCPACLDGLRPS
QVDMHRGQNPLLVPLLFKFRRMTARRRIDGKVFFHIFYRSPCGRSLCDMQEVQEYLLETR
CDFLFLEMFCMDPFVLVNRARPPSTSTGKPHLYLPDISEGREVLPVPCINEVDNTLAPNI
TYTKDRVPAPGVSVNTSPDFLIGCDCTDGCQDRSKCACHQLTVEATSLCSGGPVDISAGY
THKRLPTTLPTGVYECNPLCRCDPRMCSNKLVQHGLQLRLELFMTQHKGWGIRCRDDVAK
GTFVCVFTGKIVNEDRMNEDNTVSGNEYLANLDFIEGVEKLKEGYESEAYCSDTEVETNK
KTIKMKTGPLWKNTRYQEDSSSGEAIEELMELDTEQEETEVNHMSFGERKLSHKPHETYK
DTQKKVTKQMREDGEETSGPKRCFAIKSFQRRVKPLETLDAKNEKTRTAVTGKNTRRLFN
GEETCYIIDARQEGNLGRFINHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIKAGTELT
WDYNYEVGSVEGKVLLCCCGSLRCTGRLL
NT seq 4770 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcagaaaagatgatgataacctcctgagaatgacaaaggatgacctgcagcgc
tggatccaggcagaggtggaccgaaaccctcatctgatgcagagacgggaacaactggcg
caggtggaggactgggtgaagcagaaggagagggaagccacttacacccaccttctgtac
agcaatgcctgcgagtcagtccatgagtgcgagtcagtgatgaagggtctttatggaatg
ctgggactggaataccgagatgaagattcggaggaggaaggaggaggagaaccacaggat
gtcattcatattacagatgacgaggaggataagcaggacaatagtgtgttaaatggagat
gatgacgatatcgttgtcattgatctgggagccacaaaagaaaccttggaaccaatgctt
gaaaaggtgactgtggccattcagaagtcgtccagactcgttcaggatttagtccagatg
gtaaacaaaacttcctccatgagtgctgcatcaccatcatcatcatctgacgtctctaac
agaccctcgtcagccttgacctttgagaccagccgttctgaatctgtcacaccaaagctg
gaaatacctgaaaaccctattgcaaaagttaagaccgaatctctaccgaaagtacctgaa
atgccctcgcttctcagcaattcagaacaatacaaacctattgccggttataagtcagat
tctaaactaacaattaagactgaaccacaactgacagcattaaccccttgggaaatgagc
atttcaaaacaacatgaaacttctgctactcttaactctccatccttaaaattaattaag
actgaacctcagttgacagcagtgagtccttcagaaacaccagaaacctttgccagacct
cattttggatccatagcaacaataaagaccgagcctcagtcgacggtgataaagtcagaa
atgacttcgcctccaagcacttcaaaacctttcaaaattgcatccattgcatcaattaag
actgaacctcagctgagagcattaactcctgaaatgtctttgcttgaacgtgattcagaa
aagtcaagcagtcttcgttcagatcacgaagcagcaagtaacactgaacgtacgttgccg
gcaatgacttatgaaattctgaaaactagtgcctgtccttattcagcatctgtagcatca
aagaagactgagcctcaagtgtcactagtgacgccttcagaaatgtcttcaccttcaagc
agttcagaacaaatggaaactgctgccagtgacaatacagcaaacgtagaaacaaaccag
actgagccggagtcgaccacagagactcctcctgaattggcatcattgcggagcaattcc
gaagaagctgaaactaatgccagccatgattcggattccacagatgagactgaacagcca
aaaccaaggagcaaacctgacaatccctctgtaacagagacaagtccaacgactaggctg
agatcttcaaaaaacaatgcgcctctcagcagcacttccagcccgcaaacggaagcaaaa
agtgcgcaaacgcctgccgatagtaatgatgaactctctgacaccgaggacctctctgtt
agtcctgctgacagtgattatgaaccccctgagtccgagtcattgtcagacagtgattat
gaaccccctaaatcacaatcaaagtcatcgagaaacagtgattttgaaccccctaaatca
caatcagagtcatcgagaaacaatgattttgaacccccaaaatcacaattagagtcatcg
agaaacaatgattttgaaccccccaaatcacaatcggagtcatcgagagacagtgattat
ggaccccctaaatcacaatccgagtcatcgagagacagtgattatggaccccctaaatca
caatcacagtcatctgtcgataatactgatgatgccagcagcagtgatgcttctgcagaa
ccttccagtcctgacggaagttacaagtcttcatccagtgagtcctccaagcaacaagaa
cataaagagataaaacttaacgttggcatggtagttttggggaaaagggcacacaacttg
tggcgtaaaggaacagtacaagaagtccaaacagaagaggatggcctcagatataaggtg
gagtctaaaagtggtaaagagattgtgctgcctgcttatcgggtggcctctctgcagcct
cccatacttaaggatttgtttattggctgtcgtgttgtggcaagcagcatagatgatgaa
ggaaaggcctcgtttaatgctgccgtattggtcgagcttcctgagcgcaagaatcgcatg
aggttcttggtgttttttgatgatggtcatgcagcttacctggcacttccagaccttcat
attgtctgcaaacaattgaaaaaggtgtggaaggacattgaggatgagaaattgcagtta
caggtgaaggaatatcttcgtgtctatcccaaccccattgctgtggtgcttcgcgcgggg
caagacactaaggcgatacggaatggcaagtttgagacctgcacggtgctccaattggat
ggcagcctgatccagatctgctttaagaaagacaagcagaaagagtggatttataaaggc
tcagacaggttggagcacattgtaaatatcaagcaacgtctggctaaagataaaccgcag
aaaaaacctctacagaaaacacaacataaaccacaacaaccgtctcaacagaaagcgcag
caacaacaacctcaacagaaagcgcaacaagctgttcaacagaaaccacaacagccatct
caacagaaaacgcaacagcctgctatatcagcaggaaatgccacgcctcagcacaacaca
actccctcctcgacagcagttcccccagcgactgttacttcaacgactgtcatctcaaca
gctgtatctcctgtgcgggtcacccgacaatctgatacagtcatcaaaacatcatctgtt
agccctcaaaatatcatgtcggctgctttccagccaaaggtcatcctccagaggttgaca
atgctttcacctgtcgtacgagctgtctcaaatttaagaagtgcaaaacgacctgcccct
gatgaggaagaagagtgtttttctgaggaagaagattgtgtttcaatgcaacaccagtac
aagtccatatacttgcatcatcgctgttgtccagcatgtctggatgggctgagaccgtct
caagtcgacatgcatcgtggtcaaaatccacttcttgtaccactgctttttaagtttcgg
cgaatgacggctagaaggcgcatcgatggaaaggtgtttttccacattttctatcgttct
ccgtgtgggcgaagcctgtgcgacatgcaggaagtgcaggaatacttgttagaaacacgt
tgtgacttccttttcctggagatgttctgtatggacccgtttgttcttgtgaatcgcgcc
cgacctccttccacatcaaccggcaagcctcacctctacctgccggacatatcagagggc
agagaggtgttgccggtgccctgcattaatgaagtggacaatacacttgctcctaacatc
acttacaccaaagacagagttccagctccgggtgtttcagtcaatacaagcccagatttc
ttgatcggctgtgactgcacagatggctgtcaggacaggtcaaagtgtgcatgccaccag
ctgaccgttgaggctacgtccctatgcagtggaggtccagtggatattagtgctggatac
acacataagagattgccaaccaccttgccaacaggggtgtacgagtgtaaccctctgtgc
cgttgtgatccgagaatgtgcagcaacaagctggttcagcacgggctgcagctgcggctg
gagctcttcatgacacagcacaagggatggggcatccgctgcagagatgatgtggccaag
ggcactttcgtgtgtgttttcactggtaaaatagtaaacgaagaccgaatgaatgaagac
aacacagtgtctggcaatgaatatttggccaaccttgacttcattgagggtgtggagaaa
ctgaaagagggttatgaaagcgaggcgtactgctctgacacagaggttgaaaccaataag
aagaccataaaaatgaaaacggggccgttatggaaaaacactcgctaccaagaagactcc
agcagtggtgaagccatagaagaacttatggagctggacacagaacaagaggaaacagaa
gtgaatcacatgtccttcggtgagagaaaactatcccataagccacatgaaacatataaa
gacactcagaagaaagtgaccaaacaaatgagagaggacggtgaagaaacctcaggtcca
aagcgttgctttgccataaagtcattccagagaagagtaaaacctctagaaaccttggac
gcaaagaatgagaaaacgaggacagctgtaactggcaagaacacccgcagactgttcaac
ggcgaggagacctgttacatcattgacgcgagacaagagggcaacctcggccgcttcatc
aaccatagctgcagtccgaatttgtttgttcagaacgtctttgtcgacacacacgacctt
cggtttccatgggtggcattcttcgccagcaagcgcatcaaggcgggtacggagttgacg
tgggattataactatgaggttggcagtgtggaggggaaggttctgctctgctgctgtggc
tctttgcggtgcacaggaaggctgctctga

DBGET integrated database retrieval system