KEGG   Sinocyclocheilus rhinocerous: 107725392Help
Entry
107725392         CDS       T04916                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00052  Galactose metabolism
srx00500  Starch and sucrose metabolism
srx01100  Metabolic pathways
srx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107725392
   00500 Starch and sucrose metabolism
    107725392
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107725392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107725392
Enzymes [BR:srx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107725392
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107725392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 107725392
NCBI-ProteinID: XP_016390119
LinkDB All DBs
Position
Unknown
AA seq 959 aa AA seqDB search
MVSYKRLTPEEVHFAGAALLDPDETTDTDLKEVNPELPLLPQSRRCSITVALLTFGGLIV
VLFGIWLLGTIFWLHKPPSTEPHRPPPPAVAKSPNGTWLQPESCSQIPEAWRFDCYPERG
AVVTEEMCHARNCCFIQRSQAKTSGRNGVPWCFYTPDCSSYELVSITDTEMGKVGKLLRN
KKTYYPKDIDALQMEVLYEEDNRLRVKITDPAEKRYEVPIDVPVVQKKASNPSYTVDFIK
EPFGLIVKRTQTGTVLLNTSIAPLFYADQFLQMSTSLPSRFIYGLGEHRSNFLHDVQWKT
LTMWARDVPPMELTNLYGVHPFYLSMESDGMAHGFFMLNSNAMDVALQPAPALTWRMIGG
ILDFYIFLGPDPSSVIAQYLDVVGKPAMPIFWALGYHLCRWGYKSSDKTWNVVKEMRNYG
IPQDVQWNDIDYMDHALDFTYDTVNFSSLPDLVKDLHRHDQHYVMILDPGISSSQLPGSY
WPFDEGMKRGIFINDSNGDVLIGKVWPGLTAFPDFSNPDTHEWWYQNLKRFHEKVPFDGV
WIDMNEPSNFFDGSLNGCPDNELENPPYTPGILGGTLKTKTVCASARQKISTHYNIHSLY
GLMEAKATESALRKITNKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFN
ILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFSRNHNSIDEQDQEPTAFSPAARTAM
KEAILLRYSLFPHLYTLFHHAHISGHTVATPLLFQFPNDEKTYGIDKQFLLGKSLLVTPV
LEAGQDYVVGYFPKGLWYDFHTGDSLISSGEEINLQAPKDKINLHLREGSVIPTQRPNTT
LWVSSGQPLHLIVSLSEDGLAKGDLFWDDGETLDTYEKDQYAYIYFTVEQNTMTSEVLHN
HEEATYITVETVSFYGVKTEPENVTVNSQEAAFTYRNNQVLTVTDLGLNLSHNFTISWM
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtacaagagactcacccctgaggaggttcatttcgcaggagctgctttattg
gatcctgatgagacgacagacacggatctaaaggaagtaaacccagaactgccactgctg
ccccagagccgtcgctgctccatcaccgttgccctgctgacctttgggggacttattgtg
gttctctttggcatctggctgcttggaactatattttggttacataagccaccctccaca
gaaccccatagaccccctccacctgctgtggctaaaagcccaaacgggacgtggctgcag
ccggagtcctgctcgcagattccagaagcttggaggtttgactgttatccagagagaggt
gcggtggtcacggaggagatgtgccacgctcgaaactgctgcttcatacagcgctcacag
gctaagacatcgggacggaatggagtgccgtggtgtttctacacacctgactgttcatcc
tacgagttggtgtccattactgacacagagatggggaaggtgggaaaactgctccggaac
aaaaagacgtattatcctaaagacatagatgcactgcagatggaggtgctgtatgaggaa
gacaacagactgcgtgtgaagataacagacccggctgaaaagaggtatgaggtgcctata
gatgttcctgtggttcagaaaaaagcatcaaatccctcttacaccgtagacttcatcaaa
gaacctttcgggctgattgtcaagagaacacagacaggaactgtactgttgaatacatct
atagctcctctcttctacgcggatcagttcctgcagatgtctacatcattaccttcacgt
ttcatatatggactgggtgaacatcgctccaactttctgcatgacgtccagtggaagact
ctcaccatgtgggctcgagatgtcccaccaatggagctgaccaacctctatggcgtccat
cccttttatctttctatggaatctgatggaatggcacatgggtttttcatgctcaacagc
aatgcaatggatgtggctctgcagcctgctcctgccctcacctggcgtatgattggtggg
atcctcgacttttacattttcctaggcccggatcccagctctgtgattgcacagtacttg
gatgttgtagggaagcctgcaatgcccatcttctgggctctgggttatcatctttgccga
tggggctacaagtcaagcgacaaaacctggaatgttgtaaaagaaatgcggaattatggg
atacctcaggatgttcagtggaatgacattgactacatggatcatgccttagacttcact
tatgacactgtgaacttttccagcctacctgacctcgtgaaagaccttcatagacatgat
caacactacgtcatgatcctggatcccggtatcagtagctctcagctgcctggctcctac
tggccatttgatgaggggatgaagaggggcatcttcatcaatgattcgaatggagacgtc
cttatcgggaaggtctggccaggactcacagcttttccagatttctccaatccagacaca
catgaatggtggtaccagaatctgaagcgtttccatgaaaaagtgccgtttgatggcgtg
tggattgacatgaatgagccatctaatttctttgatggatcactgaatggttgcccagac
aatgaactggaaaatcctccctacacaccaggtattctgggtggtacattaaagaccaag
actgtgtgtgcatctgcaagacagaaaatctccactcattacaacatacacagtctgtat
ggactcatggaagctaaggctactgaaagtgctttgaggaagatcacaaataagcgtccc
ttcgtcatttcccgctctacgtttcccagtcagggcaagtattcaggccactggctcgga
gacaacaggagccaatggaaagacctggccacatccataccaggtatgctaacatttaac
atcctgggcattcctcttattggggctgacatctgtggctttgggggtagcactacagaa
gaactgtgtgtccgatggacccagcttggagctttctaccccttttcaagaaatcacaac
tccatagatgaacaggatcaggaaccaacagcattcagcccagcagctcgtacagcaatg
aaagaagccattctcctgcgttattccctgttcccacatctctacacactcttccatcac
gcacacatcagtggacacacagtcgccacaccactgctctttcagttcccgaacgatgag
aagacgtacgggatagataaacagttcctattgggaaagagtttgctggtcacaccggtt
ttggaggcagggcaagattatgttgtgggatatttccctaaaggtctctggtacgatttc
cacactggtgactcgttgataagcagtggagaagagatcaatcttcaggctccaaaagac
aaaatcaacctgcatctcagggagggttcagtcatacctacacagagacctaacaccacc
ctgtgggtgagcagcggtcagccccttcatctgattgtgagtctgagtgaggacggcctg
gccaagggtgatttgttttgggatgatggagagacccttgacacatatgagaaagatcaa
tacgcttacatctatttcacagtagaacagaacacaatgacatcagaagtgctgcataat
catgaggaggctacttacatcacagtggaaaccgtttcgttttatggagtgaagacagag
ccagaaaacgtaacagtgaattcacaagaggcagcattcacttaccgtaacaatcaggtg
ctgacagtaacagacttgggtctgaacctcagtcataacttcacgatcagttggatgtaa

DBGET integrated database retrieval system