KEGG   Sinocyclocheilus rhinocerous: 107725632Help
Entry
107725632         CDS       T04916                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00500  Starch and sucrose metabolism
srx01100  Metabolic pathways
srx04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107725632 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107725632 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:srx01003]
    107725632 (gys2)
Enzymes [BR:srx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107725632 (gys2)
Glycosyltransferases [BR:srx01003]
 Polysaccharide
  Storage polysaccharide
   107725632 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 107725632
NCBI-ProteinID: XP_016390449
LinkDB All DBs
Position
Unknown
AA seq 701 aa AA seqDB search
MRLSRSLSITSLSGLPLWEEESLPVQDLLLFEVSWEVTNKVGGIYTVIQTKAKITVDEWG
ENYIMMGPYYEHNFKTQVEKCEPPNQAIKAAMDSLNNNGCQVHFGRWLIEGSPYVILFDI
GAAAWNLDRWKGDLWNACSIGLPYHDREANDSLIFGSLVAWFFKELTDQLQDKPNVIAHF
HEWQAGTGLVLSRSRKIPLATVFTTHATLLGRYLCAGNADFYNNLDKFNIDQEAGERQIY
HRYCLERAAVHCAHVFTTVSQITAVEANHMLHRQPDVVTPNGLNVRKFSAMHEFQNLHSM
NKAKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSD
VTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKRLYESLLRGEIPDMSKI
LDRDDFTIMKRAIYATQRHTFPPVTTHNMLDDSTDPILSNIRRIGLFNGRNDRVKIVFHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFME
EHVSDPSEYGIYIVDRRFRSADESCNQLTQFLFSFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRFYMHARHLALSRSFPGKFKMDHLNLAPTQGFRYPRPASVPPSPSASLHSTPHHSDE
EDDDTYDEEEEAEKDRQNIKAPFTLGAEPEGKSKQLLENGN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgcgactatccagatctttgtcaataacgtcattaagtggacttccattatgggaagag
gaaagtctacctgtgcaagacctcttgctttttgaggtctcgtgggaagtcaccaataag
gttgggggtatatacactgttattcagactaaagcaaagatcactgtggacgaatgggga
gagaactacatcatgatgggaccttactacgaacacaacttcaagacccaggtggagaaa
tgtgaacctccaaaccaagccatcaaagctgctatggactccttgaataataacggttgc
caggtgcattttggccgctggttgattgagggcagtccatacgtcatcctctttgatatt
ggggcagctgcctggaacctggaccgctggaagggggatctgtggaacgcgtgcagcatc
ggactaccctatcatgacagggaggccaatgactcgctcatctttggttctcttgtggcc
tggttcttcaaggagttaacagaccaactacaggacaagcccaacgtaattgctcatttc
cacgagtggcaggctgggacaggacttgtactaagccgctcccgaaagattcccttggca
actgtttttactacacatgccaccctactggggcggtatttgtgtgccggtaatgcagac
ttctacaacaacctggacaagtttaacatagatcaagaggcaggggagagacagatctac
catcggtactgtttggagagagccgcggtacactgtgcacatgtcttcaccaccgtgtcc
cagatcacagctgtggaggccaatcatatgctccacagacaaccagatgtcgtcacccca
aacgggttgaatgttaggaagttctctgccatgcatgagttccagaacctgcactccatg
aacaaagccaaaatccaggagttcgtaaggggtcatttctatggccatctggacttcaat
ctggaaaagaccttattctttttcatcgcaggacgatatgagttttctaataaaggagca
gacctgtttcttgaatctctgtccagattaaactacttgctaagggttcataagagtgat
gttacagtggttgtgtttttcatcatgcctgccaaaaccaacaacttcaacgtggagtct
cttaaaggacaggctgtacgcaagcagctgtgggacaccgctcagtcggtgaaggagaag
tttggcaaaaggctttatgagagcttgttaaggggtgagatcccagacatgagcaaaatc
ctggacagagatgatttcacaatcatgaagagggccatttatgcaacacagagacacact
tttcctccagtaacgactcacaacatgctggacgactccacagacccgatcctgagcaac
atccgccgaatcggcctcttcaatggacgcaatgacagagtgaagattgtgttccatccg
gagttcctgtcctccaccagccccttgctgcccatggactatgaggagtttgtgcgcggc
tgccatctgggagtgtttccatcctactatgaaccatggggctacactccaggtgagtgt
actgtcatgggcatccccagcgtgactaccaacctgtctgggtttgggtgtttcatggag
gaacatgtatctgacccctctgaatatggaatctacattgtggaccggcggttccgttct
gcggatgagtcgtgtaaccagctgactcagttcttgttttcattctgccagcagtcacgt
agacagcgaataatccaacgcaaccgcacggagagactctctgacctgctggactggaga
tacctcggacggttctacatgcatgcccgacatttggccctcagcagatccttccctggt
aaattcaaaatggaccatcttaacctcgcaccgacacaaggcttccgttacccccgaccc
gcttctgtccctccatccccatcggcttccctccactccacccctcaccacagcgatgag
gaagatgacgacacctatgatgaagaggaggaggcagagaaggacaggcagaacattaag
gcaccattcactctgggtgcagagcctgagggtaagagcaaacaactgctggaaaatgga
aattaa

DBGET integrated database retrieval system