KEGG   Sinocyclocheilus rhinocerous: 107725668
Entry
107725668         CDS       T04916                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107725668
   04068 FoxO signaling pathway
    107725668
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107725668
SSDB
Motif
Pfam: CDI Rad50_zn_hook
Other DBs
NCBI-GeneID: 107725668
NCBI-ProteinID: XP_016390511
UniProt: A0A673KVQ5
LinkDB
Position
Unknown
AA seq 183 aa
MSKVRVSNGSPTLERVDARQADHAKPPVCRNLFGSVDREEFARDVKEQMLDMEKASKEKW
NYDFAKNEPLAPGDYEWQEVDAKEVPEFYTRPPHAKRDTSTGTVDHNGNHDYLLTTSVQG
DSDNAEHGSRSDCRTALTTPTKRPSTEDRDLPCQSKRANVQATEANCCPETSSQAPSKSD
PKT
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcaaaagtgcgcgtctccaatggaagcccgacgctggagagggtggacgcgaggcag
gcggatcacgccaaaccgccggtctgcagaaacctcttcggctccgtggatcgcgaagag
ttcgcgagagacgtcaaggagcaaatgctggacatggagaaagcgtccaaggaaaaatgg
aattacgacttcgccaaaaacgagccgctcgcgcctggcgactacgagtggcaggaggtg
gacgcgaaagaggtgccggagttttacaccagaccgcctcacgcaaaacgggatacctcg
accgggactgtggatcataacgggaaccacgactacttgttgacaacgagcgtacagggg
gactcggacaacgcggagcacgggagtcgctcggattgccgaacggcgctgaccacgccg
acaaaaagaccgtcgacagaggatcgggatcttccttgccaaagcaaaagagccaacgtc
caagcgaccgaggcgaactgctgtccagagacgagttcgcaagcgcccagcaagtcggat
cccaaaacgtaa

DBGET integrated database retrieval system