KEGG   Sinocyclocheilus rhinocerous: 107725965
Entry
107725965         CDS       T04916                                 

Definition
(RefSeq) uncharacterized protein LOC107725965
  KO
K05461  KIT ligand
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107725965
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107725965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107725965
Cytokines and growth factors [BR:srx04052]
 Growth factors
  Growth factors (RTK binding)
   107725965
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107725965
NCBI-ProteinID: XP_016390889
UniProt: A0A673NIX4
LinkDB
Position
Unknown
AA seq 270 aa
MFHMREVKSGESICVLVLLFSGLVTCSGVFGSPLTDDVATLETLSENIPSDYRIPIRFIT
KDVGGACWLYVNLYHVESSLKTLALKFGNLSTNKVNITIFITMLEGFRFTLDSEELEVTM
QTFECHYRRGTWPTRRYFNHVKEVLTAAGSTVGKFHDCTPPPCKTPPAPPFTPGESRQQN
GMSGAIHGLLALLIIPSMALLVLTVTLVFRRSDCCAQRMHEVSLNEPHDGAEESRTGPHN
GAAQGHPDSSSSSQQDRAWVDSLGCADTEV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgttccacatgagggaggttaagagcggagaaagcatttgtgtattagtgttgcttttt
tctgggcttgtgacctgctcaggtgtttttggaagccctttaacagatgatgttgccacg
ttggaaacactgagtgaaaacattcccagtgactacagaatacctatccgcttcatcacc
aaggatgtgggtggagcttgctggctatatgtgaacctgtatcacgttgaaagcagttta
aaaacattggccctcaagtttggcaacctgtccaccaataaagtgaacatcactattttt
ataacaatgctggagggttttcgtttcactctggacagtgaggagctggaggtgacaatg
caaacattcgagtgccactacagaaggggaacgtggccgactagacgttactttaaccat
gttaaagaggttcttacagcggctggatccacggttggcaaatttcatgactgcacacct
cctccttgcaagaccccaccagctcctcctttcacaccaggtgaaagcagacagcagaac
ggtatgagcggagcaattcatgggctcttggcgctgctcatcatccctagcatggcgctt
ctggtcctcactgtcacgttggtattcagaagaagcgactgttgtgcgcaaagaatgcat
gaagtcagcttgaatgaaccccacgacggagctgaagaaagcagaaccgggccccacaac
ggagctgcgcaagggcaccctgattccagctctagcagccaacaggacagggcgtgggtg
gattccttagggtgtgcagacacagaggtttaa

DBGET integrated database retrieval system