KEGG   Sinocyclocheilus rhinocerous: 107726167
Entry
107726167         CDS       T04916                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04141  Protein processing in endoplasmic reticulum
srx04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107726167
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107726167
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107726167
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107726167
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf MCU YabA
Other DBs
NCBI-GeneID: 107726167
NCBI-ProteinID: XP_016391169
LinkDB
Position
Unknown
AA seq 687 aa
MMTAELDSRFCADNLLTSEDWDACLYQCEDMEEDFTGELKYDTALDSDLVLTLDPDNPTS
PWKNLDDNLTGEVSIMKDYNRTITQPLPVDMFFQVKTEPPSPASSLTSDSSISSIPEAQQ
VTVKSENPPTPPYMYGDVLLPPLTSVEVTVTSVSPLHQPPLPLAIQPHALSSLDTQTTVL
SSAATLKASSILSSKPLIQPKPVCVAALPVAQSTSPAKALLLQSVPVPIPAIDQNTTPVV
LSQSVCLGSAPAIVKMEPLSPSMPHCTSPSAPPPSKPIIPASNLTGNSCSDIDMKVLKRQ
QRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRLAGREATESGSNKR
ALCVMALFLFITFTFSPVSLKDRTLEAGIEEAAIPLTGRRLLEFERSQELSRKRASERTT
EQKTDRGEEERWRKGELDKKAAVSYQFRNQSDVFSDVKDLLLQDIDRYFSSSDCRQFNRS
ESLRLADELRGWVHRHQNNRKSNGKAKVVKKTKIAQQKAQHRKTNFSRYLPIQAHRSIES
QLQVLPGPEISYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMAI
NDSVYNSSQGGYEMMMQVDCEVMDPRIIPIKSSVVPPSLRDPPPTPPPHHHHGNHTSLRS
RQQHLHGSGASSRRRAAGYFISQSGSD
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgatgaccgcggagctggacagtcgcttctgcgccgataacctgctaaccagcgaggac
tgggatgcctgtctgtatcagtgtgaggatatggaggaggatttcaccggagaactgaaa
tatgacacagcgctggacagtgatcttgtcctcacgctggaccctgataaccccacatca
ccgtggaagaacctggatgacaacctgacaggtgaagtgtcaatcatgaaggattataac
aggactataacacagcctctgccagtggacatgtttttccaggtgaagactgaacctccg
tcacctgcgtcgtctctgacctctgacagctccatctcatctatacctgaagctcagcag
gtgacggtgaagagtgagaacccgcccactccaccgtacatgtatggagacgtgctcttg
ccgccgctgaccagcgtggaggtaaccgtcaccagcgtctctccactgcatcagcctccc
cttcctctggccatacagccacacgctctcagcagcctcgacacacaaaccacagtcctc
tcctcagcagcgacgctgaaggccagcagcattctgagcagtaaacctctgatccagccc
aaacctgtgtgtgtggccgcgttgccggtggctcagagcaccagtccagccaaagctctc
ctcctgcagagcgttcccgtacccatcccagccatcgaccagaacaccacgcccgtggtt
ctgtctcagtcggtgtgtctgggttctgctcctgctattgttaaaatggagcctttgtct
cccagtatgcctcactgcactagcccctcagccccgcccccgagcaaacccatcatccca
gcatccaacctgactggaaacagctgcagtgacatcgatatgaaggttttgaagaggcag
cagcgtatgataaagaaccgggaatcggcctgccagagccgcaagaagaagaaggagtac
ctgcagaacctggaggcgcagctgcgggaggcgcagcaggagaacgagcgcctgcgcaga
gagaaccaagcgctgcggctcgccgggagagaggctacggagtctggcagcaacaagaga
gctctgtgtgtgatggctctgttcctcttcatcacctttaccttcagccccgtcagtctc
aaagacaggacattggaagctgggattgaggaagcggctattcctctgacaggaagacgc
ctgctggagtttgagagatctcaggagctgagcaggaaacgggcaagcgagagaaccacg
gagcagaagacggacagaggggaggaagaacgctggaggaaaggagagctggacaagaag
gctgcagtctcgtatcagttcaggaatcagagcgatgtgttcagtgatgttaaagacctc
ctccttcaggacatagacagatatttctcgtcctctgactgcagacagttcaaccgctct
gagtccctcaggttggcagatgagctgcgtggatgggtccatcgtcatcagaataaccgg
aagtctaatggaaaggcgaaggttgtgaagaaaactaaaatagctcagcagaaagctcag
cacagaaagacaaacttttccaggtaccttccaattcaggctcatcgttctatcgaaagt
cagctgcaggtcctgcccgggccagagatcagctacagcgactttctggacgctattgat
cggcgtgaggacactttctacgtcgtatcattcagacgggatcacctgctgttacctgcc
atcagccacaataaaacaactcgacccaaaatgtctctggtcatgcctgccatggccatc
aatgattcggtgtataactcgtctcagggcggctatgaaatgatgatgcaggtggactgt
gaggtgatggacccccggatcatcccaatcaagtcctctgtagtcccgccctctctcaga
gacccgccccccactccgccccctcaccatcaccacggcaaccacacctccctccgcagc
cgacagcagcacttgcatggcagcggggcgtcatcgagacggagggccgcaggttacttc
atcagccagagcggatccgattga

DBGET integrated database retrieval system