KEGG   Sinocyclocheilus rhinocerous: 107726386
Entry
107726386         CDS       T04916                                 

Definition
(RefSeq) cellular tumor antigen p53-like isoform X1
  KO
K04451  tumor protein p53
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04216  Ferroptosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107726386
   04310 Wnt signaling pathway
    107726386
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107726386
  09143 Cell growth and death
   04110 Cell cycle
    107726386
   04210 Apoptosis
    107726386
   04216 Ferroptosis
    107726386
   04115 p53 signaling pathway
    107726386
   04218 Cellular senescence
    107726386
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107726386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107726386
   03036 Chromosome and associated proteins [BR:srx03036]
    107726386
   03400 DNA repair and recombination proteins [BR:srx03400]
    107726386
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107726386
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107726386
DNA repair and recombination proteins [BR:srx03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107726386
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 107726386
NCBI-ProteinID: XP_016391429
UniProt: A0A673JMX1
LinkDB
Position
Unknown
AA seq 371 aa
MAESQEFADLWERNLISTQEGGPCWDLINDEQYLPGSFDLNIFSNVLTEQPQPSTSPPTA
SVPVATDYPGEHGFKLGFPQSGTAKSVTCTYSADLNKLFCQLAKTCPVQMVVDVAPPQGS
VIRATAIYKKSEHVAEVVRRCPHHERTPDGDALAPPAHLIRMEGNSRAVYREDDITYRHS
VVVPYEAPQLGAEWTTVLYNFMCNSSCMGGMNRRPILTIITLETHEGQLLGRRSFEVRVC
ACPGRDRKTEESNFRKDQETKTLGKTPSTTKRSMTKESSSSTPRPEGRRKAKLSASSDEE
IYTLQVRGKERYEMLKKINDSLELSDVVPPSDMDRYRQKLFTKGKKEKDGQTPEPKRSKK
LMVKDEKSDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcagaaagtcaagaatttgctgacctgtgggagcgaaacctcatttccactcaggaa
ggtggcccttgctgggacttgatcaatgatgagcagtatcttccaggctctttcgacctg
aatatttttagtaatgtgctgactgaacagcctcagccttccacctcccctccgaccgcc
tctgttcctgttgccactgattatcctggggaacatggcttcaaactgggcttccctcaa
tctggcactgccaagtctgtcacctgcacgtactcggctgacctgaataagctcttttgc
caattggcgaaaacgtgtccagttcagatggtggtggacgttgcccctccccagggctcg
gtgatcagagccacagccatttataagaagtccgaacatgtggctgaggtggtccgtcga
tgtccccaccatgagagaaccccagatggcgatgcattggctcctcctgctcacctgatc
cgaatggaaggaaactcgcgtgctgtttacagagaggacgacataacctacaggcacagt
gtggtggttccctatgaagctcctcaactgggagcagaatggacaactgttttgtacaat
ttcatgtgcaacagcagttgcatgggtggcatgaaccgccgacccatcctcacaatcatc
actctggagactcatgaaggtcagttgctgggccgcaggtctttcgaggtgcgtgtgtgt
gcgtgcccaggcagagaccggaaaactgaggagagcaacttcaggaaagaccaggagacc
aaaaccttgggcaagaccccttctaccaccaaacgcagcatgactaaagaatcatcttca
tccacacctcgacctgagggcaggaggaaggccaaactgagcgcgagcagtgatgaggag
atctataccctgcaggtgaggggtaaggaaaggtatgaaatgttgaagaagattaacgac
agtttggaattgagcgacgtggtacctccatctgatatggacagataccggcagaaatta
ttcaccaagggcaagaaggagaaggatggccaaacgcctgagcccaaaagaagcaaaaaa
ctaatggttaaagatgaaaaaagtgactcggattag

KEGG   Sinocyclocheilus rhinocerous: 107744460
Entry
107744460         CDS       T04916                                 

Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04216  Ferroptosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107744460
   04310 Wnt signaling pathway
    107744460
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107744460
  09143 Cell growth and death
   04110 Cell cycle
    107744460
   04210 Apoptosis
    107744460
   04216 Ferroptosis
    107744460
   04115 p53 signaling pathway
    107744460
   04218 Cellular senescence
    107744460
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107744460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107744460
   03036 Chromosome and associated proteins [BR:srx03036]
    107744460
   03400 DNA repair and recombination proteins [BR:srx03400]
    107744460
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107744460
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107744460
DNA repair and recombination proteins [BR:srx03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107744460
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 107744460
NCBI-ProteinID: XP_016413613
LinkDB
Position
Unknown
AA seq 371 aa
MAESQEFADLWERNLISTQEAGTCWELISDEQYLPSSFDPNIFDNVLTEQPQPSTSPPSA
SVPVATDYPGEHGFKLGFPQSGTAKSVTCTYSSDLNKLFCQLAKTCPVQMVVEVAPPQGS
VIRATAIYKKSEHVAEVVRRCPHHERTPDGDGLAPAAHLIRVEGNSRALYREDDVNSRHS
VVVPYEAPQLGAEFTTVLYNFMCNSSCMGGMNRRPILTIITLETHDGQLLGRRSFEVRVC
ACPGRDRKTEESNFRKDQETKTLGKTPSANKRSLTKESTSSVPRPEGSKKAKLSGSSDEE
VYTLQVKGKDRFEMLKKINDSLELSDVVPPSEIDKYRQKLLTKGKKEKDGQTPEPKRGKK
LMVKDEKSDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcagaaagtcaagaatttgctgacctgtgggagagaaacctcatttccactcaagaa
gccggcacttgctgggaattgatcagtgatgagcagtatcttccaagctccttcgatcca
aatatttttgataatgtgctgactgaacagcctcagccgtccacctcccctccgtccgcc
tctgttcctgttgccactgattatcctggggaacatggcttcaaactggggttcccgcaa
tctggcaccgccaaatctgtgacctgcacttactcatctgatctgaataagcttttttgc
caattggcgaaaacttgtccagttcagatggtggtggaagttgcccctccacagggctcg
gtgatcagagccacagccatttataagaagtccgaacacgtggctgaggtggtccgtcga
tgtccccaccatgagaggaccccagatggtgatggattggctcctgctgctcacctgatc
cgagtggaaggaaactcacgtgctctttacagggaggatgatgtcaactcgaggcacagt
gtggtggttccctacgaagctcctcaactgggagcggagtttacaacggtgctatacaac
tttatgtgcaacagcagttgcatgggtgggatgaatcgccggcccatcctcacaatcatc
actctggagacgcatgacggtcagttgctgggccgcaggtctttcgaggtgcgtgtgtgc
gcgtgcccaggcagagaccgaaaaactgaggagagcaacttcaggaaagaccaggagacc
aaaaccttgggcaagaccccctctgctaataaacgtagtttgacgaaagagtcaacttca
tctgtgcctcgacctgagggcagtaaaaaggccaaactgagtgggagcagtgatgaagag
gtgtataccctgcaggtgaagggtaaagacagatttgaaatgttgaagaagattaacgac
agtttggagttgagcgacgtggtgcctccatctgaaattgacaaataccggcagaaatta
ctcaccaagggcaagaaggagaaggatggccaaacacctgagcccaaaagaggcaaaaaa
ctaatggttaaagatgaaaaaagcgactcggattag

DBGET integrated database retrieval system