KEGG   Sinocyclocheilus rhinocerous: 107727259
Entry
107727259         CDS       T04916                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107727259
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107727259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107727259
   00536 Glycosaminoglycan binding proteins [BR:srx00536]
    107727259
Cytokines and growth factors [BR:srx04052]
 Growth factors
  Growth factors (RTK binding)
   107727259
Glycosaminoglycan binding proteins [BR:srx00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107727259
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107727259
NCBI-ProteinID: XP_016392547
UniProt: A0A673HIW4
LinkDB
Position
Unknown
AA seq 158 aa
MTERDITAFTLLPTNTEQKDPKHNSLQKLYCRNGGYHLRIQPNGTVDASRQDNDVYTLLK
VKAVKAGIVAIRGHETGLYLAMDKYGKLYGTVMLNDECYFIEKIEENHYNTYRSQKYQEN
GDWYVGIKKNGRTKNGSKTHKGQNAIYFLPIPVDGSIQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaccgagcgggatatcaccgctttcacactccttccgacgaacaccgagcagaaagat
cccaaacataactctctgcaaaaactttactgcaggaatggaggataccatctccggatc
caacctaacgggactgtggacgcgagtcgacaagataacgacgtttacactcttttaaag
gtaaaagcagtgaaggcaggaatagtggctattaggggtcatgagactggactatacctg
gcaatggacaaatatggaaaactttacggcactgtcatgttgaacgatgagtgttacttc
attgagaagatagaggagaaccactacaacacataccgctcacagaagtatcaggagaac
ggagactggtacgtggggatcaaaaagaatggacgcacgaaaaacggctccaaaacacac
aagggccaaaatgcaatctacttcctgccgattccagtggatggcagcatacagtaa

DBGET integrated database retrieval system