KEGG   Sinocyclocheilus rhinocerous: 107727938Help
Entry
107727938         CDS       T04916                                 

Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00512  Mucin type O-glycan biosynthesis
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107727938
Enzymes [BR:srx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107727938
Glycosyltransferases [BR:srx01003]
 O-Glycan biosynthesis
  Mucin-type
   107727938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107727938
NCBI-ProteinID: XP_016393472
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MMRFAGFRTPKSFMAFVMRRWKILLVLNVFTVAGFITFWGKCNLRTTKVVGQQAAAADVR
GQTYLNGSAQETSITHDVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGRGGLPATLM
PEEEKEAKYLREKYGYNAFLSDTISLDRSIPDYRPSKCKKAFYSRDLPQISIIFIFVNEA
LSVILRSVHSAVNHTPAHLLKEIILVDDNSDDVQLKGPLEEYVNKRYPGLIKIVRNQKRE
GLIRARIEGWKVATGEVTGFFDAHVEFTPAWAEPVLSRIKENHKRIILPSIDNIKDETFE
LERYENSGHGYNWELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVVNREYFGELGLLD
AGMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEV
WMDQYKSNVYLAWNLPMKNHGIDYGDISQRLALRKRLQCKSFEWYLDNIYPEMKRYNNTL
FYGEIRNTNVTHLCLDQGIKENHTATLHPCHGWGPQLGRYTKEGYLFLGPLGSTGEDTRC
VVDDKISSYPQLLNCEKVSSVPQKTWHFAQNEAIINRATGRCLEVVPANVYFGYALILRS
CTGQKWTVKNLMKQD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgattcgctggattccgaacaccaaaatctttcatggcctttgtgatgagaaga
tggaaaatcttactggtgctgaatgtgtttacggtggccggcttcatcactttttggggc
aagtgcaatttacgcacaaccaaagttgtgggtcaacaggcagcagctgctgatgtgaga
ggacagacatatctgaatggatctgctcaggagaccagcatcactcatgatgtgctctta
aagagactgggatcattggaagatgtggtgtacagacaactgaatggtttgtccaagtct
cttggactcattgaaggttttggaggccgaggtagaggaggtctaccagcaacacttatg
ccagaggaagaaaaggaggccaaatacctgagggagaaatatggctacaatgcatttctg
agtgacacaatctctctggatagatctattccagattatcgacccagcaaatgcaaaaag
gccttttattcccgtgacctgccacagatctccatcatcttcatctttgtaaatgaggca
ttgtctgtcatcctgcgttcagtccattcagctgtcaaccacacaccagctcatctccta
aaggaaatcatcttggtggatgacaacagcgatgacgtacaactgaaagggccactggag
gagtatgtcaacaagcgctacccgggtcttatcaaaatagtgcgcaatcagaagagagag
ggcctcatccgtgcccgcatcgagggttggaaagtggccactggggaggtgactggcttc
tttgatgcccatgttgagttcacgcctgcatgggctgagccagttctgtctagaatcaag
gagaaccacaagaggatcatactgccctccatagataacattaaagatgagacgtttgag
ctggaacgctatgaaaactcaggccacggctataactgggagctctggtgtatgtatatc
agcccaccgaaacagtggtgggatgaaggagacacttctgcacctatcaggacgcctgca
atgataggctgctcttttgtggtaaaccgggaatactttggggagttgggcctactggac
gcagggatggacgtgtatggaggcgaaaatatagagctgggaatcagggtttggctgtgc
gggggaagcatggaagttctgccttgttccagagtggcccatattgctagaacaaaaaag
ccctaccacagtaacatcgcctttcacactagacgcaatgcacttcgggtggcagaagtg
tggatggaccaatacaaatctaatgtctatttggcatggaacctaccaatgaagaaccat
ggcattgactatggagacatatcccagagactagcgctcaggaaaagactccagtgcaaa
agctttgagtggtaccttgacaatatctatccagagatgaagagatacaacaacactctc
ttttatggagagattcgcaataccaatgtgacccatctgtgtttggaccagggcataaag
gaaaaccacacagcaactctgcacccctgccatggctggggccctcagctgggtcgctac
actaaggagggttatcttttcctgggtcctctgggaagcactggcgaagatactcggtgt
gtggtggacgataaaatcagcagctacccacagctcctgaattgtgagaaagtctctagc
gtaccccagaaaacttggcactttgcacagaatgaagcaatcatcaaccgagctacagga
cgctgtctcgaggtagtgccggctaatgtctacttcggctatgctctgatcctgcgttcc
tgcactggccagaagtggaccgtcaagaatttgatgaaacaggactaa

DBGET integrated database retrieval system