KEGG   Sinocyclocheilus rhinocerous: 107728386Help
Entry
107728386         CDS       T04916                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00010  Glycolysis / Gluconeogenesis
srx00030  Pentose phosphate pathway
srx00051  Fructose and mannose metabolism
srx00052  Galactose metabolism
srx01100  Metabolic pathways
srx01200  Carbon metabolism
srx01230  Biosynthesis of amino acids
srx03018  RNA degradation
Module
srx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107728386
   00030 Pentose phosphate pathway
    107728386
   00051 Fructose and mannose metabolism
    107728386
   00052 Galactose metabolism
    107728386
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107728386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107728386
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:srx03019]
    107728386
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107728386
Protein phosphatases and associated proteins [BR:srx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107728386
Messenger RNA biogenesis [BR:srx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107728386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107728386
NCBI-ProteinID: XP_016394008
LinkDB All DBs
Position
Unknown
AA seq 835 aa AA seqDB search
MPDTKKFIENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVD
GGDNIKEASWESVSSMLQVGGTVIGSARCKDFRTHEGRLRAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLDELVQSGEISEEASQIHSALHIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPKDGWE
EQMCYKLSENRADKKRLNIIIVAEGAIDQSNKPITTELIKDLVVRCLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEASPGTPACVVSLCGNQAVRVPLMECVQMTQEVQK
AMDEKRFEEAVRLRGRSFENNLNTYKLLSHRKIDSELPHSSFNVAVLNVGAPAAGMNAAV
RSAVRVGITEGHTMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKHID
KIAEQMRIHNINALLVIGGFEAYLGLMELQAARSKHAELCVPMVMVPATVSNNIPGSDLS
IGADTALNAITDAFESLLQLVDARSRYEEFCVPMCMLPATISNNVSGTDLSIGADTSLNA
IVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEPFDIRELQSN
VEHLTEKMKTSIQRGLVLRNENCSENYTTDFIYQLYNEEGKGVFDCRKNVLGHMQQGGAP
SPFDRNFGTKIAAKAMQWISKKLKEFYREDEGRVFANTEDSACLLGMRRRALVFQPVIQL
KDETDFVHRIPKEQWWLRLRPLMKILAKYKTSYDVSDSGQLEHIVRLRAKDISAI
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaccaaaaaattcatcgagaacctgtctggagcagggaagtgcattggcgtc
ctgacaagtggtggagatgctcaaggtatgaatgctgctgtgagggcagtggtcagaatg
ggaatctatgttggagcaaaagtttatttcatccatgagggctaccagggcatggtggat
ggaggtgacaacatcaaagaggcatcatgggaaagtgtttccagtatgttacaagtgggt
ggcaccgtgattggcagcgcccgttgtaaggattttcgcacccacgagggccgtttgcgt
gctgctctgaacctggtgcagcgtggcatcactaacttgtgtgtgattggtggagatggc
agtttgaccggggctaatctcttcagggaggagtggagcggactgttggatgagcttgtc
caatcaggtgaaatcagtgaagaggcttcccaaattcattctgcattgcatatcgttggg
atggtgggctcaatagacaatgatttctgtgggacagatatgaccattggcactgactca
gcattgcacaggatcatagaggtggtggacgccataatgaccacggcacaaagccatcag
aggacctttgtgctggaggtcatgggaagacactgcgggtatctagcattagtcagtgct
cttgcatgtggagctgactgggtgctgattccagaaatgcctcccaaagatggctgggag
gaacagatgtgttataaactatcagagaatcgtgctgataagaaacggcttaatatcatc
atagtagctgaaggtgcaatagaccaaagcaacaagcccataaccacagaacttataaag
gatctggtggtgcgctgtttggggtttgacacgcgggtcacaattctgggtcacgtccag
agaggaggaacaccctctgcctttgaccggattttggcgagtcgtatgggagtggaagcc
gtcttggccctgttagaagcttctcctggtactccagcatgtgtggtgtctctgtgtggg
aaccaggctgtcagggttcctctgatggagtgcgttcagatgacgcaggaggtccagaag
gccatggatgaaaagcgatttgaagaagctgtaaggctgcgtggcagaagtttcgaaaac
aacctgaacacttataaactcttgtctcatcgaaaaattgattctgaacttccacatagc
tcatttaatgtggctgtgttgaatgttggcgctcctgcagctggcatgaatgcagccgtg
cgttcggccgtcagggttgggatcaccgaaggccacactatgtttgctgttagtgatggg
tttgagggcttctataagggacagattaaagaaatcaagtggggtgatgttgggggctgg
acaggccagggcgggtccctgctaggaacaaaaagaactctcccagccaagcacattgat
aaaattgcagaacagatgaggattcacaacatcaacgctttactggttattggaggtttt
gaggcttatttggggctgatggagctgcaagcagctcgttccaagcacgcagagctttgt
gttcccatggtgatggtcccggccactgtgtccaacaatatccccggctcagacctgagt
atcggggcagacacggccctcaacgccatcacggacgcctttgagagtttgctgcagctg
gtcgatgcccgcagcaggtatgaggagttctgtgtgcccatgtgcatgctgcctgccacc
atcagtaataatgtgtccggcactgacctcagcattggcgctgacacttccctcaatgcc
atagtggagacgtgtgatcgtataaagcagtcggccagtggaaccaagcgccgcgtgttc
atcattgagacgatgggcggttactgtggttacctggcgacggtgggcgggctggcggcc
ggagcggatgcagcctacatctatgaagagccgtttgacatccgagaactacagtctaac
gttgaacatttaactgagaagatgaagaccagcatccagagaggtttagtgctcaggaat
gagaactgcagtgagaactacaccactgacttcatctaccagctgtacaatgaagagggc
aaaggagtctttgactgcaggaagaacgtcctgggacacatgcagcagggtggtgctccc
tccccgtttgacaggaactttggcacaaagatcgcagctaaagccatgcagtggatctcc
aagaagctcaaagagttttacagagaagatgaaggacgtgtgtttgcaaacacagaggat
tctgcgtgtttgttggggatgcggcgaagggctctggtctttcagcccgtcatacagctg
aaggatgagacggattttgttcacaggatcccgaaggaacagtggtggctccgtctgcgt
ccactcatgaagattctggccaagtacaaaaccagctacgatgtgtccgattcgggccag
cttgaacacatcgtccgtctgagagctaaagacatctctgccatttaa

DBGET integrated database retrieval system