KEGG   Sinocyclocheilus rhinocerous: 107729189
Entry
107729189         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 3-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04114  Oocyte meiosis
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04350  TGF-beta signaling pathway
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04540  Gap junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107729189
   04012 ErbB signaling pathway
    107729189
   04350 TGF-beta signaling pathway
    107729189
   04370 VEGF signaling pathway
    107729189
   04371 Apelin signaling pathway
    107729189
   04068 FoxO signaling pathway
    107729189
   04150 mTOR signaling pathway
    107729189
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107729189
  09143 Cell growth and death
   04114 Oocyte meiosis
    107729189
   04210 Apoptosis
    107729189
   04218 Cellular senescence
    107729189
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107729189
   04520 Adherens junction
    107729189
   04540 Gap junction
    107729189
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107729189
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107729189
   04621 NOD-like receptor signaling pathway
    107729189
   04625 C-type lectin receptor signaling pathway
    107729189
  09152 Endocrine system
   04910 Insulin signaling pathway
    107729189
   04912 GnRH signaling pathway
    107729189
   04914 Progesterone-mediated oocyte maturation
    107729189
   04916 Melanogenesis
    107729189
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107729189
   04270 Vascular smooth muscle contraction
    107729189
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107729189
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107729189
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107729189
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107729189
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107729189
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107729189
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107729189
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107729189
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2 YukC Pkinase_fungal
Other DBs
NCBI-GeneID: 107729189
NCBI-ProteinID: XP_016395093
LinkDB
Position
Unknown
AA seq 324 aa
MRRQTGGPLPPKDCTKATDLWTETMAESGSSAAAAGAAGSNSSTAGAGGAVAPGGANGAA
GSKPGLESVKGQNFDVGPRYTDLQYIGEGAYGMVCSAFDHVNKIRVAIKKISPFEHQTYC
QRTLREIKILLRFRHENIIGINDILRARRIEYMRDVYIVQDLMETDLYKLLKTQQLSNDH
ICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLT
EYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGKNQ
CLMLNGMSPFSDFSFILKSALPEA
NT seq 975 nt   +upstreamnt  +downstreamnt
atgagaaggcaaacaggaggccctcttcctcccaaagactgcacgaaggcgactgatttg
tggacagaaacgatggcggaatcgggcagcagcgcggcggcggccggagccgcgggctcg
aatagcagcaccgccggggctggaggagccgtcgcgcccgggggagccaatggagcggcg
ggatccaagcctggcctggagtcggtgaagggacaaaattttgacgttggcccccgatac
accgatctccagtacatcggggagggggcctatgggatggtctgctcagcttttgatcat
gtgaataagatccgagtggccattaagaagatcagtccatttgaacaccagacctactgc
cagcgcaccctgagggagatcaaaatcctcctgcggttccgtcatgagaacatcatcggc
atcaatgacatcctgagagctcgtcgcatcgaatatatgagggatgtctatatcgtacag
gacctgatggagaccgacctttacaaattgctgaaaacacagcaactcagcaatgaccat
atctgctactttctgtaccagatcctgcgagggctgaaatacattcactctgccaatgtg
ctgcacagagacttgaagccttcgaaccttctcatcaacaccacctgtgacctcaagatc
tgtgactttgggctggcacggatagccgacccagaacatgaccacaccggattcctcaca
gagtatgtggctactcgctggtaccgtgctcctgagatcatgctcaactccaagggctac
accaagtccattgatatttggtctgtgggttgcatcctggctgagatgttgtctaacaga
cccatcttccctgggaagcattatctggaccagctcaaccacatattgggtaagaaccag
tgcttaatgctcaatggaatgtccccattttcagacttctctttcattctcaaatctgcg
ctacctgaagcataa

KEGG   Sinocyclocheilus rhinocerous: 107741490
Entry
107741490         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04114  Oocyte meiosis
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04350  TGF-beta signaling pathway
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04540  Gap junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107741490
   04012 ErbB signaling pathway
    107741490
   04350 TGF-beta signaling pathway
    107741490
   04370 VEGF signaling pathway
    107741490
   04371 Apelin signaling pathway
    107741490
   04068 FoxO signaling pathway
    107741490
   04150 mTOR signaling pathway
    107741490
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107741490
  09143 Cell growth and death
   04114 Oocyte meiosis
    107741490
   04210 Apoptosis
    107741490
   04218 Cellular senescence
    107741490
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107741490
   04520 Adherens junction
    107741490
   04540 Gap junction
    107741490
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107741490
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107741490
   04621 NOD-like receptor signaling pathway
    107741490
   04625 C-type lectin receptor signaling pathway
    107741490
  09152 Endocrine system
   04910 Insulin signaling pathway
    107741490
   04912 GnRH signaling pathway
    107741490
   04914 Progesterone-mediated oocyte maturation
    107741490
   04916 Melanogenesis
    107741490
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107741490
   04270 Vascular smooth muscle contraction
    107741490
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107741490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107741490
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107741490
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107741490
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107741490
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107741490
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107741490
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107741490
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 107741490
NCBI-ProteinID: XP_016409717
UniProt: A0A673JQH4
LinkDB
Position
Unknown
AA seq 367 aa
MATAAVSAPAGGGPNPGAEMVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKVRVAI
KKISPFEHQTYCQRTLREIKILLRFKHENIISINDIIRTPTIDQMKDVYIVQDLMETDLY
KLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV
ADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHY
LDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLDKM
LTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKETLKELIFEETAR
FQPGYRP
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcgacagcagcggtatctgcccctgctggcggcggcccgaaccccggtgccgagatg
gtccgcggtcaggctttcgacgtcgggccgcgctacagcaacctctcgtacatcggagaa
ggcgcatacggcatggtttgctcggcgtatgatcgtgataataaagtgcgtgtggcgata
aagaaaatcagtccgtttgagcaccagacatactgtcagcgcacactccgtgagattaaa
atcctgctccgcttcaagcacgagaacatcatcagcatcaacgacattatccgcactccc
accatcgaccagatgaaagacgtctacattgtacaggatctgatggagacggacttgtac
aagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtaccagatc
ttgcgcggcctgaagtacatccactcggcaaacgttctccacagagacctgaagccatct
aacctgttgctcaacactacttgcgacctcaagatctgtgattttgggctcgcccgggtg
gccgatccagaccatgaccacaccggcttcctgacggagtatgtagccacgcgttggtac
cgcgcaccagagattatgctcaattctaagggttacactaagtccattgatatatggtcg
gtcggttgtattctggctgagatgctttcgaatagacccatcttccctgggaaacactat
ctggaccagcttaaccacatcttaggtattttgggctccccctctcaggaggatctcaac
tgcattatcaacattaaggcgagaaattacctgctgtcacttcctctccgctgcaaagtg
ccctggaaccgcctgtttcctaacgccgaccctaaagcgttggacctgttagataagatg
ttgacctttaaccctcataagaggattgaggtggaggaggcgctggctcacccgtacctg
gagcagtactatgacccctcagatgagcctgttgctgaggctccgtttaagtttgatatg
gagctagatgacttgcccaaagagactttgaaagagctgatctttgaagaaactgcacgc
ttccaaccaggctaccgaccatag

KEGG   Sinocyclocheilus rhinocerous: 107755584
Entry
107755584         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04114  Oocyte meiosis
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04350  TGF-beta signaling pathway
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04540  Gap junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107755584
   04012 ErbB signaling pathway
    107755584
   04350 TGF-beta signaling pathway
    107755584
   04370 VEGF signaling pathway
    107755584
   04371 Apelin signaling pathway
    107755584
   04068 FoxO signaling pathway
    107755584
   04150 mTOR signaling pathway
    107755584
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107755584
  09143 Cell growth and death
   04114 Oocyte meiosis
    107755584
   04210 Apoptosis
    107755584
   04218 Cellular senescence
    107755584
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107755584
   04520 Adherens junction
    107755584
   04540 Gap junction
    107755584
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107755584
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107755584
   04621 NOD-like receptor signaling pathway
    107755584
   04625 C-type lectin receptor signaling pathway
    107755584
  09152 Endocrine system
   04910 Insulin signaling pathway
    107755584
   04912 GnRH signaling pathway
    107755584
   04914 Progesterone-mediated oocyte maturation
    107755584
   04916 Melanogenesis
    107755584
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107755584
   04270 Vascular smooth muscle contraction
    107755584
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107755584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107755584
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107755584
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107755584
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107755584
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107755584
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107755584
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107755584
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 107755584
NCBI-ProteinID: XP_016427955
UniProt: A0A673N8H1
LinkDB
Position
Unknown
AA seq 392 aa
MAESGSSAAAAGTAGSSSIAAGAGAAVAAGGANGAAGSKPGLESVKGQNFDVGPRYTDLH
YIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDI
LRARRIDYMRDVYIVQDLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRD
LKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSI
DIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQ
KPKIPWSKLFPKADNKALDLLDRMLTFNPIRRITVEEALAHPYLEQYYDPSDEPVAEEPF
TFNMELDDLPKEKLKELIYEETARFQATYQGS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggaatcgggcagcagcgctgcggcggccggaaccgcgggctcgagtagcatcgcc
gccggggctggagcagccgtcgcggccgggggagctaatggagcggcgggatccaagccc
ggcctggagtcggtgaagggacagaattttgacgttggcccccgatacaccgatctccat
tacatcggggagggggcctatggaatggtctgctcagcttttgataatgtgaataagatc
cgagtggccattaagaagatcagtccgtttgaacaccagacctactgccagcgcaccctg
agggagatcaaaatcctcctgcggttccgtcatgagaacatcatcggcatcaatgacatc
ctgagagcgcgtcgcatcgattatatgagggatgtctacatcgtacaggacctgatggag
accgacctttacaaattgctgaagacacagcaactcagcaacgaccatatctgctacttt
ctgtaccagatcctgagagggctgaagtacattcactctgccaatgtgctgcacagagac
ttgaagccctcgaaccttctcatcaacaccacctgtgacctcaagatctgtgactttggg
ctggcacggatagccgacccagaacatgaccacaccggattcctcacagagtatgtggct
actcgctggtaccgtgctcctgagatcatgctcaactccaagggctacaccaagtctatt
gatatttggtctgtgggttgcatcctagctgagatgttgtccaacagacccatcttccct
ggaaagcattatctggaccagctcaaccacattttgggtattttgggctccccctctcaa
gatgatctgaactgcatcatcaacatgaaggccaggaactacctccagtctctaccccag
aaaccgaaaatcccatggagcaagctgttccccaaagcagacaacaaagctctggattta
ttggaccgcatgttaacctttaaccccatcagacgtataactgtggaggaagcactggcc
cacccctacctggagcagtactatgacccctctgatgagccggtggctgaggagcccttc
actttcaacatggagctggacgaccttcctaaagagaagctgaaagagctcatctatgag
gagacggcacgcttccaggccacctaccagggctcctga

KEGG   Sinocyclocheilus rhinocerous: 107755839
Entry
107755839         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04114  Oocyte meiosis
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04350  TGF-beta signaling pathway
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04540  Gap junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107755839
   04012 ErbB signaling pathway
    107755839
   04350 TGF-beta signaling pathway
    107755839
   04370 VEGF signaling pathway
    107755839
   04371 Apelin signaling pathway
    107755839
   04068 FoxO signaling pathway
    107755839
   04150 mTOR signaling pathway
    107755839
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107755839
  09143 Cell growth and death
   04114 Oocyte meiosis
    107755839
   04210 Apoptosis
    107755839
   04218 Cellular senescence
    107755839
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107755839
   04520 Adherens junction
    107755839
   04540 Gap junction
    107755839
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107755839
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107755839
   04621 NOD-like receptor signaling pathway
    107755839
   04625 C-type lectin receptor signaling pathway
    107755839
  09152 Endocrine system
   04910 Insulin signaling pathway
    107755839
   04912 GnRH signaling pathway
    107755839
   04914 Progesterone-mediated oocyte maturation
    107755839
   04916 Melanogenesis
    107755839
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107755839
   04270 Vascular smooth muscle contraction
    107755839
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107755839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107755839
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107755839
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107755839
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107755839
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107755839
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107755839
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107755839
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 107755839
NCBI-ProteinID: XP_016428256
UniProt: A0A673NLP6
LinkDB
Position
Unknown
AA seq 369 aa
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDINRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtatctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcggtcaggctttcgacgtcgggccacgttacactaacctctcgtacatc
ggagaaggcgcatacggcatggtttgctcggcgtatgatcgtgataataaagtgcgtgtg
gcgataaagaaaatcagtccgtttgagcaccagacgtactgtcagcgcacactccgtgag
attaaaatcctgctccgcttcaagcacgagaacatcatcggcatcaacgacatcaaccgc
accccaaccatcgaccagatgaaagacgtctacattgtacaggatctgatggagacagac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtac
cagatcttgcgtggcctgaagtacatccactcagcaaacgttctccacagagacttgaag
ccatctaacctgttgctcaacactacttgcgacctcaagatctgtgattttgggctcgcc
cgggtggctgatccagaccatgaccacactggcttcctgacggagtatgtagccacgcgt
tggtaccgcgcaccagagattatgctcaattccaagggttacactaagtccattgatata
tggtcggtcggttgcattctggctgagatgctttcgaatagacccatcttccctggaaaa
cactatctggaccagcttaaccacattttaggtattttgggctccccctctcaggaggat
ctcaactgcattatcaacattaaggcaagaaattacctgctgtcacttcctctccgctgc
aaagtgccctggaaccgcctgtttcctaatgcagaccctaaagcattggacctgttggat
aagatgttgacatttaaccctcataagaggattgaggtggaggaggcgctggctcacccg
tacctggaacagtactatgaccccacagatgagcctgttgcagaggctccatttaagttc
gatatggagctggatgacttgcccaaagagactttgaaagagctgatctttgaagaaact
gcccgcttccaaccaggctacagaccatag

DBGET integrated database retrieval system