KEGG   Sinocyclocheilus rhinocerous: 107729869Help
Entry
107729869         CDS       T04916                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8-like
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00061  Fatty acid biosynthesis
srx00140  Steroid hormone biosynthesis
srx01100  Metabolic pathways
srx01212  Fatty acid metabolism
Module
srx_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107729869
   00140 Steroid hormone biosynthesis
    107729869
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107729869
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     107729869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 107729869
NCBI-ProteinID: XP_016396076
LinkDB All DBs
Position
Unknown
AA seq 166 aa AA seqDB search
CPLFHSVSESFISTSWQCAGLCLIFCTDVVFQGTFLVTQAVSKALVSAGAVKGSIITVGS
IVGKVGNIGQVNYSASKAGVEGLTRTAAKELSKFGIRCNCVLPGFITTPMTDKVPEKVID
KLTAVIPMGRMGEPAEVADACAFLASDDSRYITGISIEVAGGLFIG
NT seq 502 nt NT seq  +upstreamnt  +downstreamnt
ctgtcctcttttccatagtgtttctgagagctttataagtacatcttggcagtgtgcagg
tctgtgtctgatcttctgtactgatgttgtctttcagggcacgtttctcgtgactcaggc
cgtctcgaaggctttagtttctgcaggcgctgtgaagggctctatcatcactgtgggcag
catagtgggcaaggttgggaatatcgggcaggtgaattactctgcttctaaagccggagt
ggagggcctcactcgaaccgctgccaaagagctgagcaaatttggcatccgctgcaactg
tgtcctgcccgggttcatcactacacccatgacagacaaagtacctgagaaagtcatcga
taaactcacagcagtcattccaatgggaaggatgggagagcctgctgaagtagctgatgc
atgtgcatttctggcttctgatgacagtcgatatattactggaatcagcattgaagttgc
tggtggactcttcattggctga

DBGET integrated database retrieval system