KEGG   Sinocyclocheilus rhinocerous: 107730086
Entry
107730086         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107730086
   04340 Hedgehog signaling pathway
    107730086
   04371 Apelin signaling pathway
    107730086
   04068 FoxO signaling pathway
    107730086
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107730086
   04115 p53 signaling pathway
    107730086
   04218 Cellular senescence
    107730086
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107730086
   04530 Tight junction
    107730086
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107730086
NCBI-ProteinID: XP_016396307
UniProt: A0A673FSH7
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIAPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDFSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccataagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaattatcttcca
tcaccaaattatttcaagtgtgttcagaaagaaatcgcacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgtgaagaacagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccaggttacag
ctgttaggagcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcactaaataaactgaagtgggatcttgcctcagtcacaccacatgatttc
attgaacacttcctcgccaaactgcctatacaccagagctccaagcagatactgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgttaacttcatcgcaagccctcca
tccatgatcgcggccggcagcgttgccgcagcagtgcaggggttgtacctgaaaagcagc
gacagttgcctctcatcccagaacctcaccaacttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacttc
tcttgcactcccacagacgtcagagacattaatatctga

DBGET integrated database retrieval system