KEGG   Sinocyclocheilus rhinocerous: 107731003
Entry
107731003         CDS       T04916                                 

Definition
(RefSeq) signal transducer and activator of transcription 3-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04217  Necroptosis
srx04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107731003
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107731003
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107731003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107731003
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107731003
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Spectrin
Other DBs
NCBI-GeneID: 107731003
NCBI-ProteinID: XP_016397461
LinkDB
Position
Unknown
AA seq 821 aa
MASQVAVRFVDNNVNMAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAY
AANKESHATLVFHNLLGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIV
ARCLWEEQRLLQTATTAQQDGQVAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLE
NLQDDFDFNYKTLKSAGELSQDLNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGL
LSAMDFVQKNLTDEELADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKL
EELQQKVSYKGDPIIQHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQ
FTTKVRLLVKFPELNYQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSL
SAEFKHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVI
SNICQMPNAWASILWYNMLTNHPKNVNFFTKPPVGTWDQVAEVVSWQFSSTTKRGLTIEQ
LTTLAEKLLGPCVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGY
IMGFISKERERAILSPKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQ
LNSMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPEAHPDTEFPDPGCVI
QPYLKTKFICVTPCPSVFMDFPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAAE
ANPGPLESLTLDMELSSDHPSPMREVFAPSTVLDMDTCRNA
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggccagtcaagttgcagtccgttttgtggataacaatgtcaacatggcccagtggaat
cagttacagcagttggagacgcggtatctggagcagctgtatcacctgtacagtgacagc
tttcctatggagctgcggcagttcttggccccctggattgagagccaggactgggcgtat
gcggccaacaaggagtctcacgccacgcttgtgttccataacttgctgggggagatcgat
cagcagtacagccgcttcctgcaggagaacaatgtcctgtaccaacacaacctgcggcgc
atcaaacagcacctgcagagcaagtatctggagaagcccatggagatcgcccgcatcgtg
gcccgctgcctgtgggaagagcagcgactgctgcagacggccaccactgcacagcaggat
ggccaggttgcccatcccactggcactgtggtgacagaaaaacagcagatactagaacac
aacctgcaggatattaggaagagagtacaggatatggagcagaagatgaagatgttagaa
aatctgcaagatgattttgacttcaactacaaaactcttaaaagtgctggagagttgtcc
caggacctgaatggaaacagccaggcagcagccaccaggcagaagatgtctcagcttgag
cagatgctgagcgctctggatcagctgaggaggcaaatagtgactgagatggcagggctg
ctgtctgccatggactttgtgcagaagaatctgacagatgaagaactggctgactggaag
aggaggcagcagatcgcttgcatcggaggaccaccgaacatctgcctggaccgcttagag
acatggatcacctctttggctgagtcgcagttgcagataagacagcagatcaagaaactg
gaggagcttcaacagaaggtctcgtacaaaggagatccgattattcaacaccgcccagct
ctggaggagaagatcgtagacctgttccgcaacctcatgaagagtgcatttgttgttgag
aggcagccttgtatgcccatgcaccctgaccgaccacttgtcatcaaaacaggagttcag
ttcaccaccaaagtcaggttacttgtgaaattcccagagttgaactaccagctgaaaatc
aaagtgtgtattgacaaggagtcaggtgacgtggcagccattcgaggttcacgaaagttc
aacatccttggcaccaacacgaaggtgatgaacatggaggaatccaacaatggcagcttg
tcagcagagttcaaacatctgactcttcgagagcagagatgtggcaatggaggccgaacc
aacagtgatgcgtctctgatagtgaccgaagaactacacctgatcacatttgagactgaa
gtctaccaccaaggactaaagatcgaccttgagacacattctctcccagtggtggtcatt
tctaatatctgtcaaatgccaaatgcatgggcgtccatcctgtggtacaacatgctgacc
aaccatcccaagaatgtgaatttcttcaccaaacctccagtaggaacgtgggatcaggta
gctgaggtggtcagctggcagttttcatccacgaccaagagaggacttaccattgagcag
ctcaccacacttgcagagaaacttctgggtccttgtgtaaactactctggttgccagata
acatgggccaagttctgcaaagagaacatggcaggaaaaggtttctcattctgggtgtgg
ctagacaacattatcgacctagtgaagaaatatattttggctctatggaatgaaggatat
attatgggcttcatcagtaaagaaagagagagggcaatcctgagcccaaagcctcctggg
actttcctgctgcgcttcagtgaaagcagcaaagagggaggcattaccttcacctgggtt
gagaaggacatcaatggtaagacccagatccagtcggttgaaccgtacactaagcagcag
ctcaacagcatgtctttcgccgagatcatcatgggctacaagatcatggatgccaccaac
atcctggtctcgccgctggtctacctctaccctgatatccccaaagaggaggcgtttggc
aagtactgccgccccgaggcccatcctgataccgaattccctgatcctggatgtgtaatt
cagccttacctgaagaccaagttcatctgtgtcaccccgtgtccttccgtcttcatggac
ttcccggacagtgagctgcttgggaacggcttccctgggactaactctggcaacacaagt
gatctgttccctatgtcccctcgcacactcgactcgctcatgcacaatgaagccgccgag
gccaaccctggacctcttgaatctctcactctggacatggagttgagctctgatcatccc
tcaccaatgagagaagtgtttgcaccctcgacagtcttggatatggacacctgcagaaat
gcttag

DBGET integrated database retrieval system