KEGG   Sinocyclocheilus rhinocerous: 107731340
Entry
107731340         CDS       T04916                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
srx  Sinocyclocheilus rhinocerous
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 107731340
NCBI-ProteinID: XP_016397881
UniProt: A0A673IKY4
LinkDB
Position
Unknown
AA seq 358 aa
MAKCELIELQDLTPDDRIELAPPLSRAGPTLERWSKEKVVRMVGERVHLEDPDWLTCKPG
RGHDFQPCSQTQLNWCDLCGEFIWSLYRQSLRCTHCNYTCHYRCQPFIQLDCSLNCDAVS
EQLNCCEDTIETDTNVDELVDWRKQELSVSEIQQKVKEYNAQVNSNLFMVLNRDGSYTGF
IKVQFKLVRPVSLPPPQITCSSSGRDGVCQEDEALKRRTSFYLPRDTVKHLHISSSTRAR
EVIEALLKKFTVVDNPAKFSLFERSERQNQVYLRKLADDERPLFLRLCAGPNEKGLSLVL
KENETGEVNWDAFSFPELQNFLRILQREEEDHVRQIVRRYALARDKMKEALKNFGTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcaaaatgtgaacttattgaattgcaggacttgactccagatgaccgcatcgagtta
gcgccccctctgtcccgcgcaggacccactctggaaaggtggagcaaagagaaggtggtg
cggatggtgggggagcgtgtgcatctggaggaccccgactggctgacgtgtaaaccgggc
cggggacacgacttccagccctgcagccagacgcagctcaactggtgcgacctctgcggg
gagttcatctggagcctgtaccgccagagcctccgctgcacacactgtaattacacttgt
cactaccgctgtcaacccttcattcaactggactgcagcttgaactgcgacgccgtcagc
gaacagctaaactgctgcgaggacacgatcgagacggacactaatgtggatgagctagtg
gactggagaaaacaggagctgtctgtcagtgaaatacaacagaaagtgaaagaatacaac
gctcaggtcaacagtaacctcttcatggttctgaaccgtgatggatcttacactggcttc
ataaaggtccagtttaagctggtccggcccgtgtctctccctcctccacagatcacgtgc
tcctcctcgggacgggatggagtgtgtcaggaagacgaagcactgaagcgtcgcacctca
ttctacctgcccagagacacggtcaaacacctgcacatcagctccagcacacgggccaga
gaggtcatcgaagccctgctgaagaaattcactgtggtggacaatccggccaagttctca
ctgtttgaacgcagcgaacgacagaaccaagtgtacttaaggaagttagcagatgatgag
cgtccgcttttcctgcgtctgtgtgctggacccaacgagaagggcctcagtttagtcctt
aaagagaatgaaacgggggaagtcaattgggatgcgttcagttttcctgaacttcagaac
ttcctgcgcatcctgcagcgggaggaggaggatcacgtacggcagatcgtgcggcgctac
gctctggccagagacaagatgaaagaggctctgaagaacttcggcacgccgggctga

DBGET integrated database retrieval system