KEGG   Sinocyclocheilus rhinocerous: 107732418Help
Entry
107732418         CDS       T04916                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00590  Arachidonic acid metabolism
srx01100  Metabolic pathways
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107732418
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107732418
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107732418
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107732418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 107732418
NCBI-ProteinID: XP_016399234
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MNSLVLFILLHLGFMVCQGANPCCSQPCQNRGVCTALGSDSYECDCTRTGYYGQNCTTPE
FLTWVKVSMKPSPNTVHYILSHFKSLWNIVNNVSFLRNGIMRYVLTSRAHLIDSPPIFNA
DYGYKSWEAYSNLSYYTRTLPPVPHDCPTPMGVAGKKELPDVKLLAEKLLLRRKFIPDPQ
RTSLMFAFFAQHFTHQFFKTDMKKGPAFTRALNHGVDLGHIYGQDLERQHKLRLFKDGKL
RYQVLDGEVYPPTVSEVQVDMHYPPHVPESRRFAVGHEAFGLVPGLMMYATIWLREHNRV
CDILKQEHPDWDDERLFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNERFQ
YQNRISSEFNTLYHWHPLMPDEFHIQDEVYNYKQFLFNTSILTDYGVNSLVESFTKQIAG
RVAGGRNVAPAVLKVAIKSIEDSRQIRYQSINAYRKRFNMKPYKSFEEMTGEKEMAAELE
EMYGDVDAVELYAGLLVEKPRTNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGG
KVGFEIVNTASLQKLVCNNVKGPCPMASFYVPNVKDSVPTTINASTSHSDQNVNPTVLLK
ERTSEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtttggtattatttattcttttgcacctggggttcatggtttgccaaggagcc
aacccctgttgctctcagccatgtcagaatcgaggtgtctgtacggcattgggctcagac
tcttatgaatgtgactgtacacgcactggatattacggtcaaaactgcactacacctgaa
tttctcacatgggtgaaagtttctatgaagccttctcccaacacggtgcattatattctc
tcacacttcaaaagcttgtggaatattgtcaacaacgtgtcgtttttgagaaacggcata
atgagatacgtgctaacatctcgtgcccatctgattgatagccctcctatattcaatgct
gactatggttacaaaagctgggaagcctactcaaatctctcctactacactcgcacgctg
cctcctgtcccgcacgattgcccaacaccaatgggagtcgcaggaaagaaagagttgcca
gacgtgaagcttctggctgagaagctgcttctcaggaggaagttcatcccagaccctcaa
cgcaccagtcttatgttcgctttctttgcccaacattttacacaccagttcttcaaaacc
gacatgaagaaaggcccagccttcacaagagccctgaatcacggggttgacttgggacac
atatacggacaggaccttgaacgccaacacaagctgagacttttcaaggatggcaagctg
agatatcaggttctggatggtgaggtttatcctccgacagtcagtgaggttcaagtagac
atgcactaccctcctcatgtacctgagtcccgtcgctttgccgttggtcacgaagccttt
ggactggttcccggactcatgatgtatgccaccatctggctgcgtgaacacaaccgagtg
tgtgatatactaaagcaggagcatcctgactgggatgacgagaggctgtttcagaccgca
cggctcatccttattggcgagacgatcaaaattgtcattgaagattatgtgcaacatctc
agtggataccactttaagctcaagtttgatcctgaacttctcttcaacgagcgtttccag
taccagaacaggatctcttctgagttcaacactctttaccactggcacccccttatgcct
gatgaatttcacatccaggatgaagtctacaattataagcagtttctcttcaacacatct
atactgacagactatggcgtcaacagcttggttgagtccttcaccaaacagattgctgga
agggtggctggagggcgtaatgttgcaccagctgtgttaaaggtggccataaagtcaatt
gaagacagcaggcaaattcgctaccaatctatcaatgcctacaggaaacgcttcaacatg
aagccatacaaatcctttgaagaaatgacaggagaaaaggagatggctgctgaacttgaa
gagatgtacggggatgtggatgctgtggagctttatgctgggctgctggttgagaagccc
aggaccaacgccatctttggggagaccatggtggaaatgggtgccccctactccctcaaa
ggacttatgggaaatcccatctgttcccccgagtactggaaaccaagcacctttggtggc
aaagtgggctttgagattgtcaatactgcctctctgcagaaattggtttgcaataatgtc
aaagggccctgccctatggcgtccttctacgtgcctaatgtaaaagattcagtaccaacc
accattaatgcaagtacttcccactcggatcaaaacgtcaacccaacagttttactgaaa
gaaaggacatctgaactctga

DBGET integrated database retrieval system