KEGG   Sinocyclocheilus rhinocerous: 107732880Help
Entry
107732880         CDS       T04916                                 

Definition
(RefSeq) uncharacterized protein LOC107732880 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107732880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107732880
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107732880
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107732880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107732880
NCBI-ProteinID: XP_016399783
LinkDB All DBs
Position
Unknown
AA seq 2129 aa AA seqDB search
MEGSYRMSVRELCETDDLATSLVLDPLLGFSTHKMNISPPPEIRRWGYLRGTLLRFKRTH
DFQATFDALLDGEWVSGYFTGLGSHRQELLKQHMYRYMTAFLLDSGVNIEPCNRYSSETN
GAKITSTRHWLVGERVEVLQGCIAELSPEDSAVLRAGVNDFSVMYSMRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGACVKVVRPISPGDEITCYYGDSFFGENNEMCECCTCERRGE
GSFKKRDQSPDVACSVDPSGQKYEFRETDLRLNRNRGNGTPKPFLTVSNSALPMRNTFSQ
RTKRNALVLSKMRKTDRWRREEQCKQVEKRTQNLLSSLPHLELKELSICLYQHSTNFLLS
CKDPLSKERALLYLTEKERPKPERITRNSKSVSPPLSSANINGPEERKDEDGEMLNEDPV
IRFKPFTLGCVSSVHERDSMKAKGRNIDASSVRIVHQGISSRTRNILRSRLSSLQARSRS
KLPRFNKRRTRLIKSNSKLSTGQNECSDSQTQDGKQQKGSEVESKDNTNPVLISPGKPCT
DKCVHIDGDTGTNSDKSSQTESTVIRETQQRVFRDCLREVAGDGRHISGSIAPRAGDVSS
CVASETSGDNKQNHRQSVSSSAVSVTPSLSSPSLNSPVSLLSGLNRYLRVSLERVAIPGK
PEVERTGQREADSTRDKVTAPAAASVQQSTNFNGSKESNIQGKKGVKELYFTPVNMESAE
KYLKVTCDLETGKNAVTQPVVKELVDVYGKDSHSEYEIEGKQDDKVVTVTSVEVTIPKNS
EDAGKKRKGADKDKKQKHVESVPKVQDKESSNKKQEEVIVEGNYLKKKVLTASFGSRTVV
VKEARVLLMDIRKSLSCKFSQQDKDANDHQPPCSYSGIGEADNMKTLLLADNKETKDKHD
ALNNKNEHPNQGLTAADQPNIHEDTQEKQSESALISSEPPSMCMVSLDHSPQSSIPLKKR
AFRESLDTDPEQDVNVPATPCTDGSKGKEPNSDNLLPKPSKSSSVDTTLMKCSIPESSLT
LKDNVCIGSIKRGSSKLIKTSAKQYCKGLQSTHRGPGKNSVRVPEYRDSTSKVHVCERTI
NDPKSEITEAVKCNMGEENQAKSDKGLGGGNKGPGDCEITDNIEHAIKDEWSTSDDLDKT
EEEQRLNVRIRLKRKRGKEWAMECTDEAKSVVDQSSPQQCLALVDPFSAILDTVSILNAE
MERIRGHGEADNGVGLEKATKAVQDVLEHCRKECAAKPCKRQQKVSAVHINKNVSTPNEI
VQDSSDVTDKQVQQKSSSPKIEADIDDIKPLPLIRLCRRAEGKWEVEWKEVQNEDGSTDT
LHREPKKLTSVFSTAAIVEQMPLGKVKEENPSQCQQLMAGRSCTFRDPLSFETSPLPISL
SLLSLYSPCYDGLAGVSNVSGSIQAKDNVREHVSDSLDSFKTGVIRTDNKGRDDICLSHN
LFQINKSLSKLQALSQSQVCEKSVPTNTSVTSSQVQSPSISPFTTECSFSNYSEDVLDFP
CLNLESYDQMPAQNNLASSLIDYCPGEPHNTGSFSSPFSQSPTDAWNPETPYLGSPSPVS
NFSSGEELCFPDIVFAQSDTSSSIGASQLLFKDKLCNTATSSAPLQDPEKDLYLSDGELS
KTPIELQVQEDSATQFLPKDLTMFNNASTSAKQPGHSTVRIHPQDKKLHFLDSIINTKSS
ESYLAKIDIKDKIHGPLNLHSSKAKSESVFPNLSTQSLHGAGPHSNLVTPFHSLHVGNKS
TSLADYPGAFNSGNALFRSSDKKLPFFPNPKNISKTEEGQNACRISVAAGSSKSHNNMES
IYACPGPSSSHSGKESSARCPNAEFSRLAENLQKKTKNIPSKQYPANPGQQGDRIHPVYF
ISSSKTTTNVFKNIKPQITRNDKDPCLPSTYLFSSSQGSQCYSTTQSKPSRLEKPHAVVT
PTQNTQLSGVSSIQPNKDQMCSNISHCDSSAFNFSSSLSPPASQHSSPRLGYRESSVPEV
PLFKTQSTTFEHGQPPHQSYVVNFTGDHSVTLGYSEDGGSLNYTGSGPANYTYHCLMEPS
GTQGRLVVEACGPSNFSPSPSASRFAGSKVHGGQVSRDQQHQGTGTHPCNSLHFSTSHSQ
STPITDRKPKRLRLVVTDGTVDLDLQYAD
NT seq 6390 nt NT seq  +upstreamnt  +downstreamnt
atggagggatcttatagaatgagtgtgagagagctttgtgagacagatgatctggccaca
agtctggtgctggatcccttactggggtttagcacccataagatgaacataagtcctccc
cctgagatccggcgatggggttacctcagagggacacttctgcgcttcaaacgcacacat
gacttccaggccacctttgatgccctgttggatggggaatgggtcagtggctatttcacc
gggctgggttcacaccgacaggagttgttaaagcagcatatgtatcgctatatgacagca
tttctgctggacagtggagtgaacattgagccatgtaaccgctattcttctgaaacgaat
ggagccaaaatcacatccacccgacactggcttgtgggagaacgggtggaggtactgcag
ggctgtatagctgagctgagccctgaggatagtgccgtcctcagagcaggagtgaatgac
ttcagcgtcatgtactcgatgcgcaagagatgtgctcagctttggttggggccggctgcc
ttcatcaatcatgactgcagacccaactgtaagtttgtccctggagataagaatggagct
tgtgtaaaagtggtgcggcccatctcgccgggggacgagattacctgttactatggggac
agcttttttggggagaataatgaaatgtgtgaatgttgcacatgtgagaggagaggagag
ggatcatttaagaagagagaccagtcaccagatgtggcttgctccgtggatccttcagga
cagaaatatgagttcagagagaccgacctaaggcttaacaggaataggggaaatggcacc
ccaaagccgtttctcactgtatcaaactcagccttgccaatgaggaatacattttcccaa
cggacaaagaggaacgcccttgttttgagcaagatgagaaagactgataggtggaggagg
gaggagcaatgcaaacaggtggaaaagagaacacaaaacctcttatcatctttgcctcac
ctcgagctaaaggagctaagcatctgcctctatcagcacagcacaaatttcctattaagc
tgtaaagaccccttgagcaaagaaagggccctgctatacctaactgagaaagagcgacca
aaaccagagaggatcacaaggaacagcaaatctgtctctccaccactcagtagtgctaac
ataaatggaccggaggagagaaaagatgaggatggagaaatgttaaatgaagaccctgtc
attagatttaaaccctttactcttggatgtgtttccagtgtacatgaaagagacagcatg
aaggccaagggacgtaacattgatgcatcatctgtcagaattgtccaccagggcatttcc
tcaaggaccaggaatattcttcgtagtcgtctgagcagtctccaagcaaggagtcgatct
aaactccccagattcaacaaaaggaggaccagactgatcaaatcgaactctaaactctct
acagggcaaaatgaatgctctgactctcagacacaagatgggaagcagcaaaaaggaagt
gaggttgagtccaaggacaatactaaccctgttttaatctctccaggtaaaccatgtact
gataaatgtgtacacattgacggagacactggaactaacagtgacaaatcatcacaaaca
gagagcacggtgatcagagagacgcagcagagagtctttagggattgcctcagggaagtg
gctggtgacgggagacacatcagcggttccattgctcctagggcaggtgatgttagttct
tgtgtagcttcagagacctcaggggataacaagcaaaaccacaggcagtctgtctcttct
agtgctgtaagcgttacaccctccttgtcttcaccatctcttaatagtcctgtctctctc
ctctcagggttaaatcgttacctcagagtcagtctggaacgggtggctatcccaggaaag
ccagaggttgaaagaacaggtcagagggaggcagacagtacaagagacaaggttacagca
ccagcagcagcgtcagtacagcagagcacaaattttaatgggagcaaagaaagcaatatt
caaggtaagaaaggggtgaaggagttgtatttcacaccagtaaatatggagagtgcagaa
aagtacttaaaagtaacatgtgatttagagactggcaaaaatgcagtcacacaacctgtt
gtgaaagaacttgtggatgtgtatggtaaggatagccacagtgagtatgaaattgaaggt
aagcaagatgataaagttgtaacagtcacatctgttgaagtcacaattcccaaaaattca
gaagatgccggaaagaaacggaaaggagcagacaaggataagaaacaaaaacatgttgag
agcgtacctaaggtgcaagataaagaaagcagcaacaagaagcaggaagaagtaattgtt
gaaggaaattacttgaaaaagaaagtgttaacagcaagttttggtagcaggactgttgtt
gttaaagaggcaagggtactgctgatggacattagaaagagtttgagttgcaagtttagt
caacaagataaagatgctaatgaccaccaacctccgtgcagttacagtggtataggagaa
gctgataatatgaagacactattacttgctgacaataaagagaccaaggacaagcatgat
gcacttaataacaaaaatgagcaccctaatcaaggactcacggcagctgatcagccaaat
atacatgaagatactcaagagaaacagtcagaaagcgctttgatttcctcagaaccccca
tccatgtgcatggtttctctggatcatagtccccagagcagcattcccctaaagaaacgg
gcatttcgagaatcgcttgatacagacccagaacaggatgttaatgtacctgcaacaccg
tgtactgatggcagtaaaggcaaagaacccaactcggacaatctgttacctaagccaagc
aaaagcagcagtgtggatacaacattaatgaaatgttcaataccagaatcaagtttaact
ctcaaagacaatgtttgcattgggtccataaagcgtggctcatccaagttgataaagact
tcggctaaacaatactgtaaaggtcttcagagtactcatcgtggaccagggaaaaacagt
gtcagagttcctgaatacagggatagcacgagtaaagtacatgtttgtgagaggacaatc
aatgaccctaagagtgaaattacagaagcagtcaaatgcaatatgggagaggagaaccaa
gcgaaaagtgacaaaggattaggaggaggaaataaaggaccaggggactgtgagatcacg
gataatattgaacatgccattaaggatgagtggtctacctcagatgatttggataagacg
gaagaagagcagaggttaaacgtcagaatccgccttaagaggaaaaggggaaaggagtgg
gcaatggagtgtacggatgaggcaaaaagtgttgtggaccagtcaagcccacagcaatgc
ttggctttagttgacccttttagtgccattttggatactgtctcgattttaaatgcagaa
atggagaggattcggggtcatggggaggccgataatggcgtaggtttagagaaagccacc
aaagcagttcaagacgtcctagaacattgcagaaaagaatgcgctgctaagccatgtaaa
agacaacagaaagtatcagctgttcacattaacaaaaacgttagtacaccaaacgaaatt
gttcaagacagtagtgatgttactgacaagcaggtacaacaaaaatcatctagtccaaaa
attgaggcggacattgatgacattaaaccgttacctcttattagattgtgcaggagagct
gaaggcaagtgggaggtggagtggaaagaagttcaaaatgaagatgggagcactgatact
ttgcacagggagccaaagaaattaacatccgtcttttctacagcagcaatagtagaacag
atgcctctcggcaaagttaaagaggaaaacccgtctcaatgccagcaactaatggcgggg
cgtagttgtaccttcagagatccactgagttttgagacttcacccttaccaatatccctt
tcacttttgtcactttactctccctgttatgatgggctggcaggagttagtaatgtcagt
gggagtattcaagcaaaagacaatgtaagggagcatgtgtcagacagtctcgatagtttt
aagactggagttattagaactgacaacaaaggaagggatgacatttgcttgagccacaat
ttgtttcagattaataaaagtctgtcaaaactccaggctctgagccagtcacaggtatgt
gagaaaagtgtgcccactaacaccagtgtaacctcttctcaggttcagtctccttccatt
tctccttttaccacggagtgtagctttagtaactattctgaagatgtgcttgactttcca
tgtttaaatctcgaaagctatgatcagatgcctgcacaaaacaacttggcaagctcttta
atagattactgtcctggtgaaccacataacaccgggtccttcagcagccccttctctcaa
agtcccactgatgcatggaatccggagaccccttacctaggatcgccaagcccagtgagt
aactttagtagtggtgaggagctatgtttcccggatattgtgtttgctcagtctgacaca
tcctcatctattggtgcgtctcaactgctctttaaagataaactgtgtaatacggccaca
agttctgctccacttcaagaccctgagaaagatctgtacttgtctgatggtgagttgtcc
aaaactcccatagagctccaggtccaggaagattcagcaacacagtttctccccaaagac
ttgacaatgtttaacaatgcatctacaagtgccaaacagcctgggcactcaactgtgcga
attcatcctcaggataaaaagttacactttcttgattccattattaacacaaagtcctcg
gagtcataccttgctaaaattgacattaaagacaaaattcatggacctctcaacttgcat
agctcaaaagctaaatccgaatctgtctttccaaacttgtcaacacaaagtctgcatggt
gccggacctcacagtaaccttgttacacccttccattcacttcacgtaggaaataagtca
acctcacttgctgattatccaggtgcattcaattctggtaatgcactttttcgtagcagt
gacaagaagcttcctttttttccaaaccccaagaatatctcgaaaaccgaggaaggccag
aatgcttgtcgaatttctgtggctgcaggcagctcgaaatcccacaacaacatggaaagc
atctatgcttgtccgggtccatcaagttctcacagtggaaaagagtcttctgctagatgt
cctaatgcggagttctcaagattggctgaaaatctgcaaaaaaaaacaaagaacatcccg
tccaaacagtaccctgctaatcctggtcagcaaggtgatcgcattcacccagtttatttc
atcagctctagcaaaaccacaacaaacgtcttcaagaacataaagccccagatcacaagg
aatgataaagatccatgcctgccctccacgtatttattttcctcatcccaaggttctcaa
tgttacagtacaacacaaagcaaaccctcaagattggaaaaacctcatgctgttgtgact
cccactcaaaacactcaactttctggagtgtcttctatccagcccaataaggatcagatg
tgttcaaacatctctcactgtgattcttctgctttcaacttcagctcctcgctttcacct
cctgcgtcgcagcacagcagtcctcgtctgggatacagagaatcctcagtccctgaggtc
cctttgtttaaaactcagtcaaccacctttgaacacggtcaacctcctcaccagtcttac
gtagtgaacttcaccggagatcattctgtgactctggggtacagtgaggatggtggaagc
ttgaattatactggttcaggacctgcaaattacacttaccattgtcttatggagccttcg
ggaactcaaggaaggctggttgtagaagcatgtggtccctcaaacttctcaccttctccc
tctgcgagtaggtttgcagggtctaaagtccacggaggccaagtcagtagggatcagcag
catcaggggacaggaactcacccatgtaattctctacacttctccacctcccactcgcaa
agcactcccataacggatcgcaagcctaagagacttaggcttgtggtgactgacggtaca
gtggatctggaccttcaatatgctgattaa

DBGET integrated database retrieval system