KEGG   Sinocyclocheilus rhinocerous: 107732972
Entry
107732972         CDS       T04916                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04260  Cardiac muscle contraction
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107732972
   04020 Calcium signaling pathway
    107732972
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107732972
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107732972
   04261 Adrenergic signaling in cardiomyocytes
    107732972
   04270 Vascular smooth muscle contraction
    107732972
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:srx04040]
    107732972
Ion channels [BR:srx04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107732972
SSDB
Motif
Pfam: Ion_trans GPHH CAC1F_C Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 107732972
NCBI-ProteinID: XP_016399934
LinkDB
Position
Unknown
AA seq 2214 aa
MVNESKNMYIPEDTLENHQGSNYSSPSLAPVPSLNEDEHVEGGGGVLGLAPEHIPTPGAP
LNWQAAINAARQAKLMGTTAAPISTASSTQRKRQHYTKPKKQASTASTRPPRALLCLTLK
NPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIF
TVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAG
FDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELF
MGKMHRTCFFFKDGHKGTISEEKPAPCAPSSTHGRHCSSANITQCMMGWAGPNDGITNFD
NFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGE
FSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMP
ASENESVNTDNAPAGDMEGETCCTRMANRISKSKFSRYSRRWNRLCRRTCRAAVKSNVFY
WLVIFLVFLNTLTIASEHHQQPDWLTNVQDIANKVMLALFTGEMLLKMYSLGLQAYFVSL
FNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNS
VRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWN
SVMFDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEE
EEEKERKKLARTASPEKRQNSEKPPLKDEKKEEKIELKSITSDGETPTATKINIDEYTGE
ENEEKNPYPVNDFPAAEEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSPNNK
FRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVNNDSFRNQILGYADYVFTGIFTIEI
ILKMTTYGAFLHKGSFCRNYFNILDLVVVSVSLISSGVQSSAINVVKILRVLRVLRPLRA
INRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDTSKQTQSE
CRGSYILFKDGNVGKPVKSQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSH
AEDVGPVYNYRVIISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ
CVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFS
KAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADP
SSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL
PYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQE
IMLACSPNRPCEKGSEVNHNSEDCGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVSKIPPKTALSLQAGLRTLHDMGP
EIRRAISGDLTVEEELERAMKETVCSASEDDIFRVKRSGGLFGNHVNYYHQSDGHASFPQ
SFTTQRPLHISKSGSPGEAESPSHQKLVDSTFTPSSYSSSGSNANINNANNTAIGHRYPK
PTVSTVDGHTGPPLTTVPLPRPTWCFPNKRSCFYDTFMRSDSSDSRLPIIRREEASTDET
YDETFLDERDQTMLSMDMMEFQDEESKQLAPMEEADVGEERRPWQSPRRRAFLCPTALGT
YSHTHSLQLIQISTIISFASNVTLKSTAYLLFNTGRRSSFHLECLRKHNRPDVSQKTALP
LHLVHHQALAVAGLSPLLRRSHSPTLFTRLCSTPPASPSGRGGGGPCYQPVPSLRLEGSG
SYEKLNSSMPSVNCSSWYSDSNGNHSRSVQRTQRPVSLTVPPVTRRDSISLAHGSAGSLV
EAVLISEGLGRYAQDPSFIQVAKQELADACDMTMEEMENAADNILNANAPPNANGNLLPF
IQCRDTGSQESRCSHTLGLSTATGSDELLGVELECSEGNSTLMEDEDMECVTSL
NT seq 6645 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacataccggaggacacccttgaaaaccatcaaggc
tccaactattccagtccgtcgttggctccagtccccagtctgaatgaggacgagcatgtg
gagggcgggggtggggtgctgggtcttgcacctgaacacattcccacccctggtgccccc
ctcaactggcaggcagccatcaacgcggcacggcaggccaagctgatgggcaccaccgca
gccccgatctccactgcgagctccacacagcgcaaacgccagcactacaccaaacccaag
aaacaggccagcactgcctccacgcgcccaccccgagcccttctctgcctcactcttaaa
aaccccatccgcagggcgtgcatcagtatcgtggaatggaaaccgtttgaaatcataatt
ttgatgactatttttgcaaactgtgtggccttagctgtctacatccctttccccgaggac
gattccaacgcaaccaactcaaacctggaacgggtggagtatctctttctgatcattttt
acggtggaagcatttctcaaagttattgcatacgggttgctgtgtcatcctaatgcgtac
ctgcggaacggctggaacttgttggatttcatcatcgtggtggtagggctgttcagtgca
atattagagcaggccactaaaggggatggtgggacttcaatgggaggcaaggctgcaggg
tttgatgtaaaagccctgcgagcctttagagtgttgagacctctgagactcgtatctgga
gtacctagtttacaggtggtgctgaactccatcattaaagccatggttcccctcctgcac
atcgctctgctcgttctgttcgtcatcatcatttatgccatcatcggcctcgagctcttc
atgggcaagatgcacagaacctgttttttcttcaaagatggacacaaaggtactatatct
gaagagaagccggccccctgcgccccaagctccacccatggacgacactgctcctcggcc
aacataacgcagtgcatgatgggatgggcgggcccaaatgatggaatcacgaactttgat
aactttgcatttgccatgctaactgtgtttcaatgcatcacgatggagggctggactgac
gtcctgtactggatgcaggatgccatgggttatgagcttccatgggtctattttgtcagt
ctggtcatctttggatcctttttcgttctaaatctggttctgggtgtgttgagcggagag
ttctctaaagagcgagaaaaggccaaagctcgtggtgatttccagaagctccgtgagaag
cagcagctggaggaggatctaaagggctacctggactggatcacgcaggcggaggatatc
gaccctgagaacgacgacgagggactggatgacgacaagcctagaaatctgagtatgccg
gccagtgaaaatgagtcagtgaacactgataatgctcccgctggagacatggagggagag
acctgctgtactcgcatggcaaataggatctccaaatccaaattcagtcgatattcacgc
cgatggaatcggttatgtcggcgcacgtgccgtgcagcagtgaagtcaaatgtgttctac
tggctggtgattttcctggtatttttgaacacgcttaccattgcctctgagcaccaccag
cagccagactggctcaccaatgtacaagatatcgccaataaggtgatgctggctcttttt
accggtgagatgctgctgaagatgtacagcctgggcctacaggcctatttcgtctccctt
tttaaccgcttcgacagttttgtggtgtgcggtggaattctggagactatcctggtagag
actaagatcatgtcacccctcggcatctctgtgctgcgctgtgtgcgtctgctccgcatc
ttcaagatcaccaggtactggaactctctcagtaatctagtggcgtctctgctgaactcg
gtgcgctctatcgcgtccctgcttttgctgctcttcctgttcatcatcatcttcagtctg
ctcggaatgcagctctttggtggcaagttcaactttgacgagacgcgccgcagcaccttc
gataacttcccccagtctctcctcaccgtctttcagattttgaccggagaggactggaac
tctgtgatgtttgatgggatcatggcgtacggtgggccctcctttcctggcatgcttgtc
tgcatttatttcatcatcctcttcatctgcggaaactacatcctcctgaatgtcttcttg
gccattgccgtggacaacctggcagacgcagagagtctgacatcagcgcagaaagaggaa
gaggaggagaaagagaggaagaagctggccagaacggccagtccagagaagcgccagaac
tctgagaaaccacctctgaaggatgaaaagaaagaggaaaagattgaactaaaatccatc
acttctgatggagagacgccaactgctaccaagatcaacatagatgagtacacaggggag
gagaatgaggagaagaacccatatcctgtgaacgatttcccagcagcagaggaggacgat
gaggagccagagatgcctgtaggtcctcgtccacgtccactctccgacattcagctgaag
gagaaagctgtccccatgccagaagccagagctttctttattttcagccccaataacaag
ttcagggttttgtgtcataagattgtaaaccacaacatcttcaccaatttaatcctgttc
tttatactgctgagcagtatttcactggcagcggaggacccagtgaataatgactcattc
aggaatcagattctaggctatgcagattatgtgtttacaggaatcttcaccatagagatc
atactgaagatgacaacgtatggagcattcctacataagggttcattttgtcggaattat
tttaatattttggatctggtggtggtcagtgtgtctctgatctcctctggagttcagtca
agtgccattaatgtagtgaagattctcagagtgctgagggtgttgaggcccctgagagca
atcaacagagccaagggcctcaaacatgtggtccagtgtgtgtttgtagccatccgtacc
atcgggaacattgtcatcgtcaccactttgctgcagttcatgtttgcctgtattggtgtt
caacttttcaagggcaaattcttctactgcacagacacctctaaacagacacagtccgaa
tgcagggggtcctatatattattcaaagatgggaatgttgggaagccagtgaaatcacag
cgttcatgggagaacagtgacttcaactttgatgatgtcctgcagggcatgatggctctg
tttgccgtgtccacttttgagggttggccagggctcctctacagagccattgactcccat
gcagaggatgttggtccagtctacaactaccgtgtgatcatctctatattcttcatcatc
tacatcatcatcattgccttcttcatgatgaacatattcgtaggtttcgtcattgtgaca
tttcaggagcagggagagcaagagtacaaaaactgtgagctggacaagaaccagcggcag
tgtgtggaatatgccctgaaggcccgtcccctgcgcaggtacatccccaagaacccgtat
cagtacaaggtatggtacgtggtgaactctacctactttgagtatctgatgttcaccctc
attcttctcaacaccatctgcctggccatgcagcatcatggccaatctcagtcattcagc
aaagccatgaatatcctcaatatgttgttcactggcctattcactgtggaaatgatccta
aaactcatcgccttcaaacccaggcattattttgttgatgcatggaacacgtttgatgcc
cttattgtagtgggtagtgttgttgatatagccatcacagaggttaacccagctgacccc
tcctcctctcccccctcctctgtggtaagaccaatgggcctccaaaacactgaagataac
gccaggatctcaatcacgttctttcggctgttccgtgtgatgaggctggtgaagctcctg
tctcggggagagggcattcggacgctgctctggaccttcattaaatcctttcaggctctt
ccctatgttgctttgctgatcgtaatgctgttcttcatctacgccgtcattgggatgcag
atgtttggtaagattgccctgagggacaacagccagatcaaccgaaacaacaactttcag
acgtttcctcaggctgttctgctgctcttcaggtgtgcaacaggggaggcgtggcaggaa
atcatgctggcctgttctccgaaccgcccgtgtgagaaggggtcagaggtcaaccacaac
agtgaagactgtggcagccactttgccatcatctactttgttagcttttatatgctttgc
gccttcctgatcattaacctctttgtggccgtcatcatggacaactttgactatttaaca
cgtgattggtcgatattggggccgcatcacctggatgagtttaagaggatatgggcagaa
tacgatcctgaggccaagggtcggataaagcacctggatgtggtgacgttgctgcgcagg
attcagcctccccttggatttggaaagctttgtccacatagagtggcgtgcaagcggctt
gtgtccatgaacatgcctctcaatagtgacgggacggtgatgttcaacgcaactctcttt
gctctggtacgaacggctctacgcatcaaaactgaaggtaacctggagcaagcaaatgag
gaactcagggccatcgtgaagaagatctggaagaggacgagcatgaagctgctggatcaa
gtcgttccccctgctggagatgatgaagtaacagtggggaagttctatgccacattcctg
attcaggaatacttcaggaaatttaagaagcgcaaggaacagggcctggtgtccaaaatt
cctccaaagactgctctttcactgcaggctggcctgcgtacactgcatgatatgggtcct
gagatcagaagagcgatatcaggagacctgactgtggaggaggagctggagagagccatg
aaggaaaccgtgtgttctgcatctgaggatgatatcttcagggtaaagcggtctggcggt
ctcttcggtaaccacgtcaactactaccaccagagtgacggccacgcctccttcccacag
tccttcacaacacagcggccgttgcacatcagtaaatccgggagtcccggcgaagcagaa
tctccctctcatcagaagctcgtcgactccaccttcactccgagcagttattcttcctca
ggatccaacgcaaacattaacaacgccaacaacacagccatcggacaccggtaccccaaa
cctaccgtcagcacagtggacggacacacggggccgcccctcaccaccgtcccactacca
cggcccacatggtgctttcctaacaagaggagctgtttctatgacactttcatgcgctct
gattccagtgacagtcgtctccctataatacggcgagaggaagcatctacagatgagacg
tacgatgaaacatttctagatgagcgagatcagaccatgctctcgatggacatgatggaa
tttcaggatgaagagagcaagcaattggctcccatggaggaggcggatgtaggggaggag
aggaggccgtggcagtctccacggcgacgggcctttctctgccccactgcactgggtaca
tactcacacacacattcattacagttaatacagatcagtacaatcattagtttcgcttca
aatgtgacgttgaagtcaactgcatatttgcttttcaacacaggtcgacggtcttccttt
cacttggagtgtctgagaaaacataacagacctgatgtttcgcagaaaacagcactacca
ctgcatctagtgcatcatcaggctctggctgtggcagggttgagtcccttgctgagacgg
agtcattctccgacactgttcacgcgtctgtgttccacacctcctgcgagtcccagcggc
cgcggcgggggaggcccgtgctaccagcccgtcccgtctctgcggttggagggcagcgga
tcttacgagaaactcaacagcagcatgccatctgtgaactgcagctcgtggtacagtgac
agtaacggcaaccacagccggagcgtgcagaggacgcagcgacccgtatccctcacggtt
cctccggtcacacgcagagactccatatccctggctcatgggagcgccggcagcctcgtg
gaggcggtgttgatatccgagggtttgggtcgctatgcacaggatccctccttcatccag
gtagcgaagcaggaactagcggacgcctgcgacatgactatggaggagatggagaacgct
gccgacaacattctcaacgccaacgcgccgcccaacgccaacggaaacctgctgcccttc
atacagtgcagagacactggctcccaggagtcccgttgcagtcacacgctgggcctctcg
accgccacgggctccgacgagctgctgggggtggagttagagtgctccgaggggaacagc
actctgatggaggacgaggacatggagtgcgtgaccagtttgtag

DBGET integrated database retrieval system