KEGG   Sinocyclocheilus rhinocerous: 107734301Help
Entry
107734301         CDS       T04916                                 

Definition
(RefSeq) calcineurin B homologous protein 1 isoform X1
  KO
K17610  calcineurin B homologous protein 1
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107734301
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107734301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 107734301
NCBI-ProteinID: XP_016401718
LinkDB All DBs
Position
Unknown
AA seq 203 aa AA seqDB search
MGLQGWRNVLALKTSKNNNRAAWQRAFPVPLSHSQITRLYSRFHSLDKGENGALSREDFQ
RIPELAINPLGDRIINAFFPEGEDQANFRGFMRTLAHFRPVEDNEKNKDLTSGEPLNSRT
NKLLFAFRLYDLDRDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDMCIS
FSEFIKVLEKVDVEQKMSIRFLH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgggtttacagggctggagaaacgttcttgccctcaagacgtccaagaacaacaaccgt
gcggcctggcagcgggcgttccctgtcccgctctcccacagtcagatcactcgcctctac
agccgctttcacagtctcgataaaggagagaacggagcgctcagccgagaagacttccag
aggattcctgagttggccataaatcctcttggtgatcggataattaatgccttcttccca
gagggtgaggatcaggcgaactttaggggcttcatgagaactctggctcatttccgtcct
gtggaggataatgagaaaaacaaagacctgacttcgggcgagccgctcaacagcagaacc
aacaaactcctcttcgctttccggttatatgaccttgacagagacgacaagatctccaga
gacgagctgctacaggtgctgagaatgatggtaggcgtgaatatttctgacgagcaactt
ggaagcattgcagacagaaccatccaggaagctgacactaatggagacatgtgtatctcc
ttcagtgagttcatcaaggtattggaaaaagtggacgttgaacagaagatgagcatccgc
ttccttcactga

DBGET integrated database retrieval system