KEGG   Sinocyclocheilus rhinocerous: 107737535Help
Entry
107737535         CDS       T04916                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00020  Citrate cycle (TCA cycle)
srx00190  Oxidative phosphorylation
srx01100  Metabolic pathways
srx01200  Carbon metabolism
Module
srx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
srx_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107737535 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107737535 (sdhb)
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107737535 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-GeneID: 107737535
NCBI-ProteinID: XP_016404528
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MSACISLTRSAVAFRNSRTLVLVRYAQTAAAPAPEPKIKRFQIYRWDPDTPGDKPRMQTY
EIDLNTCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNT
SKVTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKRGKEQYLQSIEDRQKLD
GLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLSKLQDPFSLY
RCHTIMNCTKSCPKGLNPGKAIAEIKKMMATYKEKKSSAI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtgcatttctttgactcgcagcgctgttgctttccgcaacagtaggacgttg
gtgctggtacgatatgcccagacagcagctgcccctgcccctgagccaaaaataaagaga
tttcagatttacagatgggaccctgacacacctggtgacaagccccgcatgcaaacctat
gagattgatttgaacacatgtggtccaatggttcttgatgctctcatcaaaattaaaaat
gaaatggacccgacactcaccttcagacgctcatgtagagagggtatctgtggctcatgt
gctatgaacatcaacggaggcaacactttagcctgcttaaacaaaatagatacaaatacc
agcaaagtgacgaagatttaccccctgcctcacatgtatgttgtgaaagatcttgtccct
gatatgagcaacttttatgcacagtacaagtccatcgagccctatttgaaaaagaaggac
gaatcaaagcggggaaaagagcagtacctccagtcaatcgaggaccgtcaaaagctggat
ggcctgtatgaatgcattctgtgtgcatgctgcagcactagttgccctagttactggtgg
aatggagacaagtaccttggtccagctgtgctcatgcaggcgtataggtggatgattgac
tctcgtgatgactttacagaagagcgtctgtccaaattacaggaccctttctccctctac
cgctgtcacacaataatgaattgtacaaagtcatgtcccaagggactcaatcctggaaaa
gccatagcagaaattaagaaaatgatggccacttacaaagaaaagaaatcgtctgccatc
tga

DBGET integrated database retrieval system