KEGG   Sinocyclocheilus rhinocerous: 107739230Help
Entry
107739230         CDS       T04916                                 

Definition
(RefSeq) neutral alpha-glucosidase C-like isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00052  Galactose metabolism
srx00500  Starch and sucrose metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107739230
   00500 Starch and sucrose metabolism
    107739230
Enzymes [BR:srx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107739230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107739230
NCBI-ProteinID: XP_016406741
LinkDB All DBs
Position
Unknown
AA seq 910 aa AA seqDB search
MEVNVSAESFESIVPGGEFQEKFKKNHDIIFYRRQRDKAVSQYFASFETLVLTDRGASLE
LCERVSQDRLCLQIRATQSGTVRVSLDELQPVKPRYHVSDVLLGELRYEPLRVNWKREDC
VCLTWGLGQYKLLVSFSPFKLEISCDGEEIVTLNPENKLYFETLQDPTRSSSDSCQDDEN
RCGLWKETFRQFEDVKANGPSSVGMDLSLHGFKHTYGLPEHADTLVLKDTSVTEAYRLYN
LDVFGYDINSRLGLYGSVPFLLAHKLERTAGVFWLNASETLVDVKYNPEPNEGEDEPPGK
KSKISPQTDVRWMSESGTIDCFILLGPTAAQVFSQYAQLTGYQALPPLFSLGYHQCRWNY
EDEADVKAVDAGFDLHGIPYDVIWLDIEHTNGKRYFTWDSELFPNPGELQHHLQKKNRKL
VVISDPHIKTDPDWPLYCEAKEGGHFVKNREGAVYEGTCWPGESCYLDFSSSKTRSWYAR
QFSLSKYEGSTESLFVWNDMNEPSVFNGPEQTMPKDAVHHGGWEHRELHNLYGFYQHMAT
FEGLLTRSGGTERPFILSRSFFAGSQRLGAIWTGDNVATWEYLKISIPMLLSLSLTGIQF
CGADVGGFVQDPDPELLVRWYQAGALQPFFRGHSAKMTKRREPWLFGDDVTSAIRSAVMD
RYHLLPYWYTLFHQAHTSALPPIRPLWVEFPNDTSMFAVENQYMIGGALLVCPVTDPEVT
EVKVLLPGSDVLWYDTNTAAVHKGARTLDLPVTLNTVPVFQRGGTVVPRRAGCGSSTADL
QQHPFTLTVALDSKGNADGLLYLDDGHSFSYRDQMQFCLRRFTMRAGRLVNSCADDQGSF
VSDDKVESVVILGLNSLKRKPKLKSGVKRPKVSFCGAPKTAVTFEFDAKRGVLTLTGLDL
EIHKDWEIVI
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaatgtttcagctgaatcttttgagagcatcgtgccgggtggtgagtttcaa
gagaagtttaagaaaaaccatgacataatattctacaggagacagagagataaagcagtg
tctcagtactttgcctccttcgaaactttagtactcacagatagaggagccagtctggag
ctctgtgaacgggtctctcaggatcggctgtgtcttcaaatacgggcaacccaaagtgga
acggtcagagtgtctcttgatgagctacagccggtgaaaccacgctaccatgtttcagat
gtactgcttggagagttgagatatgagccgctgagagttaattggaagagagaggactgt
gtatgtctaacttggggtctgggacagtacaagttgctggtttccttttctcctttcaaa
ctcgagatttcctgtgacggagaggagattgtcactctcaacccagaaaacaaactctac
tttgagactctgcaagatccaactaggtcatcttcagattcatgccaggatgatgaaaat
cgatgtgggctgtggaaggaaacatttagacagtttgaggacgtcaaagcaaatggtcct
agttctgtggggatggacttaagtctccatgggttcaagcatacgtatggtcttcctgaa
catgctgataccctggtgttgaaggacacaagtgtcacggaggcgtataggctgtacaac
ctggatgtgtttggctatgacatcaatagcaggttgggtctttatggttctgtccccttc
ctgctagctcacaagctggagaggacagctggagtgttctggctgaacgcctctgagact
ctggttgatgtcaagtacaacccagagccaaatgagggcgaggatgaaccaccagggaag
aaaagcaagatctcaccacagactgatgtgagatggatgtcagagagcggcacaatcgac
tgtttcattttgctgggacccacagctgcccaggtgttctctcagtatgctcaacttaca
ggctaccaggctcttcctccactcttctctttgggttatcaccaatgccgctggaactac
gaggacgaggcagatgtgaaagcggtggatgctggatttgacctccacggtattccgtat
gatgttatatggttggacatagagcacacaaatgggaagcgctacttcacctgggattcc
gagctttttccaaacccaggagaactacagcatcaccttcagaagaagaacaggaagttg
gtcgttattagtgatccgcacatcaagactgatcctgattggccgctttactgtgaagct
aaagaaggggggcattttgtgaagaatagagaaggtgctgtttatgaaggaacatgttgg
cccggtgaatcctgttatttggacttcagtagctcaaagacaaggtcatggtatgccaga
cagttctctctaagcaaatatgaaggctcaacagaatctttgtttgtgtggaatgacatg
aatgaaccatctgtctttaacgggccagagcagacaatgcccaaagatgcagtgcaccac
ggaggatgggaacacagggaactacacaacttgtatggcttttatcagcatatggctaca
tttgagggcttattaacacggtcaggtggcacagagaggccgtttatcctttcacgctct
ttctttgctgggtctcaaagattaggtgccatctggactggggacaatgtcgctacttgg
gagtacttgaagatttcaatacccatgctgctgtcgctgagtttgacaggaatacagttt
tgtggagctgatgtagggggctttgtgcaggatccagaccctgagcttctggtccgctgg
taccaagcaggtgctcttcagccatttttcaggggacactctgctaaaatgaccaagcgg
cgtgaaccctggctgtttggggacgatgtgacctctgcgatccgctctgctgttatggac
agataccatctcctgccgtactggtacactctgtttcaccaagcacacacgtcagccctg
cctcccatcagacctctttgggtagagtttcccaacgatacaagcatgtttgcggtggag
aaccagtacatgattggcggtgctctccttgtgtgccctgtgacagatcctgaggtcaca
gaggtcaaggttttgctcccagggtctgatgtgctgtggtacgacacaaacacggcagcg
gtacacaagggtgccagaactctggatctgccagtgactctgaacactgtgcctgtgttc
cagcgtggggggacagtggtgcccaggagagcaggttgtgggtccagcacagcggactta
caacagcatccattcactctcactgtggccctggacagtaagggcaatgctgatggactt
ctttatctggacgatggccactcttttagttacagagaccaaatgcagttctgtctgcgc
cgttttaccatgcgagctggcaggcttgtcaacagctgtgctgatgatcaaggctcgttt
gtctcggatgacaaagtggaatcagtggtcattcttggtctgaatagcttgaaaagaaaa
cccaagctcaaatcaggtgtgaagaggccaaaagtttccttctgtggtgcgccgaagaca
gcagtcacatttgaatttgatgcaaagcgaggtgtgttaactttaactggactggaccta
gaaatacacaaagactgggaaatagtaatttag

DBGET integrated database retrieval system