KEGG   Sinocyclocheilus rhinocerous: 107739809Help
Entry
107739809         CDS       T04916                                 

Definition
(RefSeq) hemopexin-like
  KO
K18977  hemopexin
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srx02000]
    107739809
   00536 Glycosaminoglycan binding proteins [BR:srx00536]
    107739809
Transporters [BR:srx02000]
 Other Transporters
  Pores ion channels [TC:1]
   107739809
Glycosaminoglycan binding proteins [BR:srx00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   107739809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hemopexin
Motif
Other DBs
NCBI-GeneID: 107739809
NCBI-ProteinID: XP_016407498
LinkDB All DBs
Position
Unknown
AA seq 444 aa AA seqDB search
MTAVLLSLYACLALALSNPVHHDVMIKDAPEGHSHPKGEDPHDAKPDRCKGIEFDAITPD
EKGNTFFFKGDHLWKGFSGPAELSNNIFNELDDSHHLGHVDAAFRMHHQDDLNVHDHIYF
FLDDKVFSYYNYTLEQGYPVEIQQEFPGVPSHLDAAVECPKGECITDSVLFFKGNEIYSF
DIKTKSVKKKVWAHLPNCTSAFRWLEHYYCFHGYNFTRFHHVSGDVTGTYPKDARNYFMR
CGEGFGHGDGARRQRCSEVKLNAITTDDKGRSYAFQDAMYIRLDTHRDGSHHFPISRLWK
EISVVVDAVFNYGDNMYIIQGDQVYIYKSAVHYTLIEGYPKPLKEELGIDGPVDAAFLCP
NQHIVNVIQGQKMYDIDLAATPRAVKMERPIPFPEIDAGFCDADGVKVFIGPEYYSYQSP
MILAMGKIKPAPQKISPEKFGCEK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggtgttactttccctgtatgcatgcttggctctagctctgagcaatccagtt
caccatgatgtcatgataaaagatgcccctgagggccattcacatcctaaaggagaggac
ccccatgatgccaaacctgatcgttgtaaaggcatcgagtttgatgccataactccagat
gaaaaaggaaacacgttctttttcaaaggtgaccatttatggaaaggtttctctggacca
gctgagctctcaaacaacatattcaacgaactggatgactctcatcacctgggtcatgtt
gatgcagccttccgcatgcaccatcaagatgatctcaatgttcatgaccacatctacttt
tttctggatgacaaagtctttagctattacaattacacccttgagcaaggctaccctgtg
gaaatccagcaggagtttcctggcgtccccagccatctagacgctgctgttgagtgtccc
aaaggagaatgcatcactgattcagtgttgttcttcaaaggaaatgaaatttatagcttt
gacatcaagacaaagtcggttaagaagaaggtgtgggcacacttgccaaactgcacatct
gccttccgctggctagagcattattactgtttccatggttacaacttcacaagattccat
cacgtttctggggatgtgacgggaacatacccaaaagatgctcgaaactactttatgagg
tgtggtgaaggatttggtcatggagatggtgcaagaagacaacgctgcagtgaggtcaag
ctgaatgctatcaccacagatgataaagggagatcatatgcattccaggatgcaatgtac
atccgtttggacacacaccgtgatggcagccaccatttccctatttcgaggttatggaag
gaaatttctgttgtggtggatgctgtttttaattatggagataatatgtacattatccag
ggtgatcaagtctatatctacaagtcagcagtacattatacgctcatagagggctaccct
aaacctctgaaggaagagctgggcatcgatggtcctgtggatgcagcatttttgtgtcca
aatcagcacatagtaaacgttattcaaggtcaaaagatgtatgacattgatcttgcggcc
acccctcgagctgttaaaatggagagacctattccctttcccgaaattgatgctggcttc
tgtgatgctgacggtgtaaaggtgtttattggtccagaatactattcatatcaaagccca
atgattctagctatgggcaagatcaaacctgcacctcaaaagatctctccagaaaaattt
ggctgtgaaaaataa

DBGET integrated database retrieval system