KEGG   Sinocyclocheilus rhinocerous: 107741080
Entry
107741080         CDS       T04916                                 

Definition
(RefSeq) putative fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107741080
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107741080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107741080
   00536 Glycosaminoglycan binding proteins [BR:srx00536]
    107741080
Cytokines and growth factors [BR:srx04052]
 Growth factors
  Growth factors (RTK binding)
   107741080
Glycosaminoglycan binding proteins [BR:srx00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107741080
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107741080
NCBI-ProteinID: XP_016409158
UniProt: A0A673N3G0
LinkDB
Position
Unknown
AA seq 151 aa
MTEADPAVKCGPPDYKKLARLYCMNGGFHLRLAADGAVAGAREEDDYSILRIKATSPGVV
VIEGAETGLYLSMNEDGKLYASVSLQKSVTDESYFLERMEENHYNTYQSQKHGENWYVGI
KKNGKMKRGPRTHIGQKAIFFLPRQVDQTKD
NT seq 456 nt   +upstreamnt  +downstreamnt
atgacggaggccgatcctgcggtgaaatgcggccctcccgactacaagaagctggcgcgg
ctgtactgcatgaacggaggatttcacctgcggctcgcggcggacggagccgtggctgga
gcgcgagaggaagacgattacagcatactgcgcataaaagctactagtccaggagtggtg
gtcattgaaggagcagagacaggactttacctctctatgaatgaagacggcaagctgtac
gcttcagtaagtcttcagaaatctgtaacagatgaaagttatttcttggagaggatggag
gaaaaccactacaacacgtatcagtctcaaaagcacggtgaaaactggtacgtcgggata
aaaaagaacggaaaaatgaaacgcggtccaagaacacacattggacaaaaggcgatcttc
tttctccctcgacaggtggaccagacaaaggactga

DBGET integrated database retrieval system