KEGG   Sinocyclocheilus rhinocerous: 107741321
Entry
107741321         CDS       T04916                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04210  Apoptosis
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04623  Cytosolic DNA-sensing pathway
srx04625  C-type lectin receptor signaling pathway
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107741321
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107741321
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107741321
   04621 NOD-like receptor signaling pathway
    107741321
   04622 RIG-I-like receptor signaling pathway
    107741321
   04623 Cytosolic DNA-sensing pathway
    107741321
   04625 C-type lectin receptor signaling pathway
    107741321
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107741321
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107741321
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107741321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107741321
Protein kinases [BR:srx01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107741321
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF1241
Other DBs
NCBI-GeneID: 107741321
NCBI-ProteinID: XP_016409509
LinkDB
Position
Unknown
AA seq 602 aa
MVQPQPSGGCTLQWELTGEETVGAEGQGSLMASSQGSMRVPPELAGNEVVNRLIADNHQL
REALKRSNDALKERCEEMEGWQRRSREERDFLSCRFREARALVQRLAQENQSLLGQLNHS
ISQTGSPRVGISKETGNQSQDQELKCTDVLMDSPEVLNEAVLTDRSEGDAYRHTMPQNLP
AEGSNEFLKLLKSHKEKLEEGMRALRRRNEELEKEKAENEKERENLHTTVEQLRSKLTQN
VGVTEESVQQTCALTVPAESSHLAKLTEQLQATQGRYRELQEKLDCLQKNSVQRDRTEAL
LKQKEKDFIQLTKDSEALRAQVTSLLGELNERQNWLEKSEAERQILEDKLCKKTERLQIL
ERDMEQQKKQHSVTVDNLLLQTQNLETALKNERLVIVEERRKLAQLQHAYTCLFQDYDKK
LKSEKQANQRSGEADTLANRLAEAEKALALKQDLIDKLKEEMEQLRATLETIPVLNAQAE
IYKMDFLAEREAREKLNQKKEELQEGLSKALVEIDRLKQEGTSRARIEEMQQRHLEDYRP
RPHPPPPAAPFAGAAMFNPAQPPSARRRDDDQDELPDYRCPKCMYKAPDMDTLQIHVMDC
IQ
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggtccaaccgcagccgtcaggtggttgcactctgcagtgggagctgactggagaggag
actgtaggtgccgagggtcaagggtcactgatggccagttcgcaggggtctatgagggtc
cctcctgaattagcgggaaatgaagtggttaatagactcatagcagataatcatcagcta
cgagaggctctaaagcgaagcaatgatgccctcaaagagagatgtgaagagatggagggg
tggcagaggaggtcgagagaggagcgcgacttcctgagctgtagatttcgtgaggccaga
gctttagtgcagcgactggcacaggaaaaccagagcctgttgggacagctcaaccacagt
atcagtcaaacagggagtccccgtgtcggcatctctaaagagactggaaatcaaagccag
gaccaagagctgaagtgcaccgatgtcctcatggactcaccagaagtattaaatgaagct
gtactgacagaccgatctgaaggagatgcttatagacacacaatgcctcaaaatttgcct
gctgagggctctaatgaatttctgaaattgctgaaaagccacaaagagaagctggaggaa
gggatgagggcactgaggaggaggaatgaggagctggagaaggagaaggcagagaatgag
aaagagagagaaaatctccacaccactgtggagcagttacgctccaaactcactcagaat
gttggtgttactgaagagtcagttcagcagacatgtgctctcaccgttcctgcagaaagc
tctcacttggctaaactaactgagcagcttcaggctacacaaggcaggtacagggaactc
caggagaagctggactgccttcagaagaactctgtgcagagagacagaactgaggctcta
ctcaaacagaaagagaaggactttattcagctgacaaaggatagtgaagctctgagagct
caggtcacgtccctactcggtgagttgaatgaacgacaaaactggctggagaaaagtgaa
gcagagagacaaattttagaggataagttgtgcaagaagaccgaacgcctgcagatttta
gagagagatatggagcaacagaagaagcagcacagtgtgacagtggacaatcttttactg
cagacacagaacctagaaactgcactgaagaacgagaggctagtcatagtggaggagagg
aggaagctggcccaactccagcatgcatacacatgtctgtttcaggattacgataaaaaa
cttaaaagtgaaaagcaagccaatcagaggagtggagaggcggacactctagctaacagg
ttagcagaggctgagaaagctctggccctgaaacaggatctcatcgataaactcaaggag
gaaatggagcagctgagagctacattagagactataccggtgctgaacgctcaggcagag
atctataagatggacttcctggctgagagggaagccagagagaaactcaatcaaaagaag
gaagagttgcaggaggggctgagtaaggcattagtcgagatagacagactcaagcaagaa
ggaacttcacgtgctcgcattgaggagatgcaacagcgacacttggaggactacaggcct
cgtccacacccgcctcctccagccgcacctttcgcaggagcagccatgttcaacccagcc
caacctccatctgcacgcagaagagatgatgatcaagacgagctgcctgattaccgctgt
cccaaatgtatgtacaaggcaccagacatggacacactgcagattcacgtcatggactgt
atccagtga

DBGET integrated database retrieval system