KEGG   Sinocyclocheilus rhinocerous: 107743106Help
Entry
107743106         CDS       T04916                                 

Definition
(RefSeq) histone deacetylase 6-like isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107743106
Protein phosphatases and associated proteins [BR:srx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107743106
Messenger RNA biogenesis [BR:srx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107743106
Membrane trafficking [BR:srx04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107743106
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107743106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 107743106
NCBI-ProteinID: XP_016411706
LinkDB All DBs
Position
Unknown
AA seq 1087 aa AA seqDB search
MDPVPGSKRSTRSPRGAPETKRENNNPNHKKNLQEARRKGRMDRSKEEEEMSNELQNLDV
RGKTKATGTGLVYVDAFTRFHCLWDASHPECPARVSTVMEMLETEGLLGRCVRVEARAVS
EDELLLVHTKEYAELMKSTQKMSEEELKTLADKYDSVFLHPEFFTSACLAVGSVLQLVDK
VMTSQLRNGFSINRPPGHHAHADKMNGCCMFNHLAIAARYAQKQHGVKRVLIVDWDVHHG
QGIQYIFEEDPSVLYFSVHRYEDGSFWPHLKESDSSSVGLGAGQGYNINLPWNKIGMEDG
DYITAFQQLLLPVAYEFQPQLVLVAAGFDSVIGDPMGEMRVSPQCFSILTHMLKGVAQGR
LVLALEGGYNLQSTAEGVCASVRSLLGDPCPHLVSPGAPSESALKSISKTISALYPFWKS
LQTFEGGPLSDVPPLPAPVCAEVKASSLITGLVYDQRMMLHHNMWDGHHPELPQRISRIF
CQHEELGLLSRCLRIPARLATEEELALCHSSEHISTIKSTEHMKPRDLHRLGNGYNSIYI
SNESYTCALMAAGSCFNSVQAILTGQVRNGVAIVRPPGHHAEKDTACGFCFFNTAALTAR
YAQCTTHESLRVLILDWDVHHGNGTQHIFEEDDSVLYISLHRYEDGTFFPSSEDANYDKV
GQGKGRGYNVNIPWSGGKMGDPEYLAAFHHIVMPIAREFAPELVLVSAGFDAARGDPLGG
YQVTPEGYAHLTHQLMSLAAGRVLVILEGGYNLTSISESMSMCTSMLLGDSPPPLDHLPP
PKTNATVTINNVLRAFSPFWSSLRIQIPESLRLALPSPKPKGKRASAGKGKKSPRQSTPA
QSPGQTPQHLEQSGLDELSKDLLSLNLNTSTSSNPSPASVPIGGARRKVKPTAQRNSADR
ESDSPLKLKSEKTRAGDDTHAEITTDRTIQESVVTGNSAAVDDQENSVLEAAGGQATMMS
VLESVFGAQATDLDTMYAVDPLPWCPHLESVRPVPAGGIDVFLPCEECGGDTENWICLFC
YKVLCGRYVKQHMVTHGQESGHPMVLSFADLSVWCYACESYVHNKVLHEAKNTAHLVKFG
EEIPPFN
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgttccaggttccaaacgttctactcgatcaccaagaggagcaccagaaacc
aaaagagaaaacaacaatccaaaccataagaagaatctacaggaggcgcggaggaagggc
agaatggatcggagcaaagaggaggaggagatgagcaatgagctccaaaacttggatgtt
cgtggtaagactaaagcaacaggaacaggtctcgtctacgtagacgcctttactcgtttt
cactgcctctgggatgccagtcacccagagtgtccagcgagagtgagcactgtgatggag
atgctggagacggaaggtctgctgggacgctgcgtacgagtagaggccagagctgtgtca
gaagatgagcttttactcgttcatacgaaggagtatgcagagctgatgaaatccactcag
aaaatgtcagaggaggagctaaagactctggctgataaatatgactctgtcttcctgcac
cctgaatttttcacctctgcctgtctggcagtgggatcggttctccagctggtggataag
gtgatgacatcacagctgcgtaacggcttctccatcaacaggcctcctggtcaccacgct
catgcagataagatgaacggctgctgtatgtttaaccatctggccatagcagcgcgctac
gctcagaaacagcatggagttaaacgagttctaattgtggattgggatgtgcatcacgga
cagggaatccaatatatttttgaagaggatcccagtgtgctgtatttctcagtgcacaga
tatgaagacggctcgttctggccgcacctcaaggagtctgacagcagttcggtgggttta
ggagcaggacagggctacaatatcaacctgccctggaacaagatagggatggaggatgga
gattacatcacagctttccagcagctactcctgcctgtggcgtatgagttccagcctcag
ctggtgttagtggcggccggatttgactctgtgatcggtgacccaatgggtgagatgcga
gtgagtccacagtgcttctccatcctgacccacatgctgaaaggtgtagcacagggacga
cttgtgctggctcttgagggtggatataacctccagtccacagcagagggtgtttgtgct
agtgtgaggtcactgctgggtgacccttgccctcatctggtctctcctggtgctccgagt
gaaagtgccctgaagtccatctcaaagaccatctcagccttgtatccattttggaagagt
cttcagacgtttgagggtggtcctctgtccgatgtccctcctctgcccgctccagtgtgt
gcagaagtgaaggcttcctctctgatcactggactagtttacgaccagagaatgatgctt
catcacaacatgtgggatggtcatcatccagagctccctcagagaatttcacgcatcttt
tgccagcatgaggagttgggtctgctgtctcgttgccttcggataccagctcgcctagca
acagaagaagagctggcactctgtcacagttctgagcacataagcactataaagagtaca
gagcacatgaagcccagagatctgcacagactgggaaacggttacaactccatctacatc
agtaatgagagctacacctgcgccctgatggccgctggctcgtgttttaactccgtacag
gccattctcacaggccaggtgagaaacggcgtggccatagtccgtcctcctggtcatcat
gcagagaaagacacagcttgtggtttctgtttctttaatacggccgctttgaccgcacgc
tatgcccagtgcaccactcacgagtccctgcgcgtccttatcctcgattgggatgttcat
catggaaacggcacacagcacatctttgaggaggatgacagtgttctgtacatctctctg
catcgctacgaagacgggacattcttccccagttcggaggatgcgaactatgataaggtg
gggcaagggaaaggcagaggatacaatgtcaacatcccctggagtggaggaaagatggga
gacccagaatacttggcggctttccatcacatagtgatgccgatagccagagagtttgcc
ccagagctggtgctggtgtctgctgggtttgatgcagcacgaggtgatccgttaggaggg
tatcaggtgaccccagagggctacgcccacctcacccatcagttaatgagcctggctgca
ggaagagtactagtcatactggagggaggatataacctcacctccatctctgagtcaatg
tccatgtgcaccagtatgttgctgggagactctcctccacctctagaccatctgccacct
ccaaagaccaatgccactgtcacgattaacaatgtcctgcgtgctttctcccccttctgg
agctccctgagaatacagattccagagtcacttcgtttggctttgccatctcctaaaccg
aaaggcaagcgggcatcggcgggcaagggcaagaaatctcctcgccagtccacccctgcc
caaagtcctggacagacaccgcagcatcttgagcagtccggccttgatgagctcagtaag
gacctgctctctctgaatctcaacacgagtacctcatctaaccccagcccagcttcagtc
cccatcggaggagccagacggaaggtgaaacccaccgcacagaggaattcagcagaccgg
gagtcagattcacccctaaaactcaagtcagagaaaaccagagctggagacgacacgcat
gcggagattacgacggaccggacgatccaagagtctgtggtcactggaaattcagctgcc
gtggatgaccaggagaactcagtgctggaggctgctggtggtcaagccactatgatgtca
gtcttagaaagtgtctttggagcacaagccacggatttggacaccatgtatgcggtggac
ccgttgccatggtgcccacacttggagtcagtgcgaccggtgcccgcaggtggcatcgat
gtcttcctgccgtgtgaagagtgtggaggtgatacagaaaactggatctgcctcttctgc
tacaaggtgctctgcgggcgttatgtgaagcagcacatggtgacccacgggcaggagtcg
ggtcaccctatggtgctgagcttcgctgacctctctgtctggtgctacgcttgtgagtca
tacgtccacaacaaggtgctccatgaagccaaaaataccgctcacctcgtgaagtttgga
gaggagattcctcctttcaactaa

DBGET integrated database retrieval system