KEGG   Sinocyclocheilus rhinocerous: 107743179Help
Entry
107743179         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107743179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107743179
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107743179
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107743179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 107743179
NCBI-ProteinID: XP_016411797
LinkDB All DBs
Position
Unknown
AA seq 2633 aa AA seqDB search
MDAQLNQELREDVTDCSIKVENFPKQVIFKGLAPRVVLTNHLLPKGTKAKVNLEEQGRQK
VSFSFAQTKKPRQNVFLAPPSPEKSASEHSSALQAGPVPTPDLAGQSDETKNVDTNTPAV
GETQTAPAPLSFPLKSKPVLGKMHFKKQILSVTVVEDNSIGSTASAEISEPVVPSKSDKI
RSSAKVETETSLQLSHKNSVIDSSSEKVLKEENPQEKVDSCLKGPVSSHIGKGDKDTSII
SEHEENRKSQPRSDCTLPGSESDGDSIRTSSSQKSSDRRNKIKSECPSNEAKRSSNSKTE
KSRHVRKEDEKGSSRSKSERDSRHTSSRSSRSDRERRRTKSRSRSRSRGCRTSSYSRSER
SRSERQSRSDRSHYHDSERRFHRSSPHRERRGSHSRTDGRSRDSSDSEDDHRRTRTRGSD
SSRSSTYSSSQKDSKLSTHSRSHRDSKPTDCSRSSESDKRTQHSKSERSHLKAGDSESNR
RSSPDAETVHKKSSAHSKSEINAKTSNSNPATSSRTSEKKVHKNSSDSDEEHRKKRQSQG
SDRSSVSGTSSSKKTDSTDHKTLNNVTGTERQSKDRSSNNTKQSQLAPSRVTPQKECSKI
DDNSTLPKSKCISQQMHEATHKVNLFKTKQQTEQQAPNQELSSLGKCTNDPESHKTTERL
KESTSTTSRSLEVRSSTDEPGMKNEIPVQSKALAEGPTDSFCVGHTPNQDSLGSLPDPLS
VKELPPGGCLKFNTKLDGPSHITQSAQLCEKDSEQHYENPEQPSSGILKKDGSAKKSRWD
IVGQVTSEYQIVNPDVEKVISVKRIEFNNDTTPEESCTQKQDSEVPSKKSVEEQIQDTTS
AESHQKVSSRASDLETQHTHGELMKQIVEDPQSTNAPVVSDLPLNCSSGSKEKINVDKPK
PETQDPDSLNHDGKCHSEDSESEESDSDSDDGRVSLKRLHSVVVVPKNSTIALETNDLTE
PSPGCLVFSGQQQTDTHESINREFAYGFSNQSKLEESPAALFKASAQAAMLNPDIKRVSY
QSQSNMVDSTSHSEATIAHVYKNWSAQERPNSVQINQASLQSFEKTSRPESDHHQNHDRP
DSWNGRKGGKQHYGESTDFNTGKGYGLAWDFNQSEQPSSTFQQPDSSHGTEHPPQPGIAL
FGSGHRQGPWTQPAISKTNRPVNAHVPFQYHDSVNQIHPDSLTNDHDEDRVVGIKQGSVL
SADLPGSSPFVQAHEISSNCSFTTESQNISEAPREDNQKPHRGRGPPKKRRQEFESESDN
EAEAGLSSKRECLDESSRVVKDGKESFHQIQEVARPLLSLKNFVDPAVWREKAKQKKMPP
YFDLIEDNVYLTERKKNKSHRDIKRMQCECAILSREERAQGMMACGEDCLNRLLMIECSS
RCLNGAYCSNRRFQMKQHADFEVILTETKGWGLRAAKDLQPNTFVLEYCGEVLDHREFKA
RVKEYARNKNIHYYFMALKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFF
TTKAVTAGAELTFDYQFQRYGKEAQKCFCGAPSCRGLIGGETRVSVRAAGGKKQRDRSRK
KDTDSALTTLDEELEALQENGEGLCGEKDVISLCRLMVRVETMEQRLTCLKLIQNTQNPL
CLKQFLDHHGLSLLWIFMVELSEAKSNSVNNIKLQLEIMKALAVLPISTKNMLEESRVLQ
FIQRWAQSRPLSQPAEQDGYSSESTSRAQTPLNTPDGPPAKLASELDGDTSKRAVYHRLK
IISENSLDSAMSDASKASDGKEEEDEEEEEMEDETSQLEATIEREVKVENSEAPSESQAE
LEPELKQEPPETEEVTHSTPEATGSEGETLETQEPEEKHIVKPEEQLEDERIVEETKSEE
PSESQTESTTVEDAPSVTDTTSAADISNDVVAEVETPMAETQVENASSEQCSSEGNESCS
TAEITPTQPSETIMESVSSESTAVAIESAPTESPSASVETTPPESAAVSTENVSSEAVVA
AGSADASALAIVAVPAEGAAVGTPSQDEEEGVSDVESERSQEPQVQASDISDMAARLLDS
WKDLKEVYRIPKKSQVEKESSDRSRDREALMTPRTPSSSRERERERDKERDRDRDRDRDW
ERERDRERDGERSSLRSADRKRRRGSTSPLPPSAYERGRRNDDRYEQSSSKKKLHTKESR
NKLSTEERRKLFEQEVAQREAQKQQQQQQQQQQQQQQQQLQTLAFNPLAYTSSPNFIAYP
PGYPIQTYVDPTNPNAGKVLLPTPAVEPLCVTPAPGTFEQTPTQPIISELNLASPSSTTT
QAGPASSLAHIPASLELSSGTQTQQFVQPAVPAQDPNMAVLSVPTQTASPQIQGQQGYTT
LWDPNTQQAVTVQTQPTQQYSTTAQPQTAIYYQGQPCQTIYSIPAGYPQTNTPVIQTYTE
PTASYLHGQQVYTGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNSIIDLPPPSPPKPKTI
ILPPSWKVARDPEGRIYYYHIITRQTQWDPPSWDGTTDEASVEHEAEMDLGTPTYDENPS
KFSTKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCMLGRISNTEDFKHLARK
LTHGVMNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYRPKEDIELD
NT seq 7902 nt NT seq  +upstreamnt  +downstreamnt
atggatgctcagttgaatcaagagctcagggaagatgtgacagattgttcgatcaaggtt
gaaaacttcccgaaacaagtcatattcaaaggccttgcacctagggttgtattgacaaac
catctcctgcctaaaggaaccaaggcgaaggtaaaccttgaggaacagggtcgacaaaag
gtctccttcagcttcgcacagacaaagaaaccacgtcaaaatgtatttctagccccacca
agtccggagaaatctgcaagtgaacattcttctgcactgcaagctggacctgtacctact
ccagatctagcaggacagagtgatgaaaccaagaatgtggatacaaatactccagcagtt
ggggagacccagacagcacccgccccattatccttccctctcaaatcaaaacctgttctt
ggaaagatgcattttaagaaacagattctcagcgttactgttgttgaggataactccatt
ggcagcactgcctcagcagagatttcagagccagtagtcccatctaagtcagacaaaatt
agatcttcagccaaggttgaaactgaaacctcattgcaactgtctcacaagaactctgtc
attgatagttcctctgaaaaagttctcaaagaggaaaaccctcaggagaaagtagattca
tgccttaaaggtcctgtttcttcccatattgggaagggagataaggatacttccattatt
tctgagcatgaggaaaacagaaaatcacaacctcgatcagattgcacgcttccaggttca
gaatctgatggggattcaatcagaacatcatctagccagaagtctagtgaccgcagaaat
aagataaaatctgaatgtccgagtaacgaagcaaaaagatcctctaattccaaaactgag
aaatccaggcatgttaggaaagaagatgaaaaggggtcaagtcgttcaaaatctgagcgc
gactccaggcacacatcgtcaagatcttctcgttctgacagggagagaagaaggaccaaa
agtcggtcacggtctagatctcgaggctgtcgaactagttcctattccaggtctgaaaga
tccaggagtgagagacagtcaaggtcagataggtcacattaccatgattctgagcggagg
tttcatagaagttctcctcatcgtgaaaggagaggctcacattcgcgaaccgatggcagg
tctcgtgacagctctgactcggaggatgaccacaggcggacaaggactcgaggtagtgac
tcaagtcgatcctccacttactctagctcgcaaaaagactcaaaattatccactcactcc
agatcccacagggactcaaaacccacagattgttctcgatcatccgagtcagacaaaaga
acccagcattcaaagtcagagcgatctcatttaaaagctggtgactctgaatccaataga
aggagctctcctgacgcagaaacagttcacaagaaatccagtgcccactcaaaatctgag
attaatgctaaaacctcaaattctaacccagctacctcatcccgaacatctgagaaaaag
gtccataaaaacagctctgactctgatgaggagcacagaaaaaaacgtcagtcacaagga
tcagacaggtcatctgtgtctgggacttcatcttccaaaaaaacagactcaacggatcac
aagactttaaataatgttactggaacagagagacaatcaaaagacagatcaagtaataac
acaaagcagtcacagttagcccccagccgagttactcctcagaaggaatgcagcaaaatt
gatgacaactctactctgcctaaatctaaatgcatttctcaacagatgcatgaagctacg
cacaaagttaatttgttcaaaacaaaacaacaaactgagcaacaagctccaaaccaagaa
cttagtagtttgggaaagtgcacaaatgatcctgagagtcacaagacaactgaaagattg
aaggaatccacttccacgacaagtagaagtcttgaagttagaagttccactgatgaacct
ggaatgaaaaatgagattccagtccaaagtaaagctctggcagaaggaccgactgactca
ttttgtgtaggccacactcccaatcaggattcattaggatcactgccagaccctctttct
gtgaaagaattaccacctggaggatgcttgaaatttaacactaaattagatgggccatcg
cacatcacacagagtgctcaactctgtgaaaaagattctgagcagcattatgagaatcct
gaacaacccagtagtggaattttgaaaaaggatggtagtgcaaaaaaatcccgatgggac
attgttggtcaagtcacttcagaatatcaaatagtgaatccagatgtggaaaaggtcatt
tcggtaaaaagaatagagtttaacaatgatactacccctgaagaatcttgtacacagaaa
caggactctgaagtaccatctaaaaaatctgtagaagaacaaatacaagacacaacctca
gctgaatctcatcagaaagtaagttctcgtgcgtctgaccttgaaacccaacatactcat
ggtgaacttatgaaacagatagttgaagatcctcaatcaacaaatgcccctgttgttagt
gatcttccccttaattgcagttctggcagtaaagagaaaatcaatgtagacaaacctaag
cctgaaactcaagaccccgattccttaaaccacgatggtaaatgccacagtgaggacagt
gagagtgaagaatcggactcagattcagatgatgggcgtgtttctttaaagcggttgcac
tcggtggtggttgtgccaaaaaattcaaccattgctcttgagacaaatgacttgactgaa
ccgtctcccgggtgtttagtgttttctggacagcaacagactgatacgcatgaaagcatt
aatagggaatttgcttatggctttagcaatcagtcaaagcttgaggaatcaccagctgca
ctttttaaggccagtgcacaagctgcaatgctaaatccagatattaaacgtgtctcctac
caatcgcagagcaacatggttgacagcaccagccattcggaggctaccattgcacatgtg
tacaagaactggagtgcccaagaaagaccaaatagtgtccagataaaccaagcatcactt
cagagttttgaaaagacttcgcgacctgaatcggatcaccatcaaaaccatgatagacca
gatagctggaatggtaggaaaggaggaaagcagcactatggggaatccactgacttcaac
actgggaagggttatggcttagcctgggactttaaccagtcagaacagcccagcagcaca
tttcagcaaccggacagcagtcatggcactgaacacccgcctcaaccaggaattgctctg
tttggtagcggtcacagacaaggtccatggactcagcctgcgatctctaaaaccaacaga
ccagtaaacgcgcatgtgccttttcagtatcatgattcagttaaccagatccatccagac
tctttgaccaatgatcacgatgaagacagggtagtagggatcaaacaaggatctgtcctg
tctgctgatcttccaggatcatccccatttgttcaagcccatgagataagcagcaattgc
agcttcaccacagaaagtcagaacatctcggaagcccctagagaagacaaccaaaagcct
catcgaggaaggggtccacctaagaagagacgtcaagagtttgaatctgaatcggataat
gaggcagaggctggtctgagcagtaaaagggagtgtttggatgagagctcaagggttgtg
aaagatggtaaggaatcttttcaccaaattcaagaggtggcgcgcccactgctcagtctg
aaaaactttgtggatccagcagtttggagggaaaaggcaaagcagaaaaaaatgccaccc
tacttcgatctcattgaagataatgtatatctgacagaacgcaagaagaataagtcccat
cgagacatcaagcgtatgcagtgtgagtgtgctatcctctcaagggaagagcgtgcccaa
ggaatgatggcttgtggggaggattgcctcaatcgcttgctgatgattgagtgctcttct
cggtgtttaaatggggcatactgctccaacaggcgctttcaaatgaagcagcatgcagac
tttgaggtaattttgactgagaccaaaggctggggcctacgagcagccaaagacctacag
ccgaacacctttgttttagagtactgtggagaagttttggatcatcgggaatttaaggca
cgggtgaaggagtatgcacgaaacaagaacattcactattatttcatggctttgaaaaat
aatgagattattgatgcgactttgaaaggaaactgttcacgtttcatgaatcacagctgt
gaacccaattgtgaaactcagaaatggactgtaaatggccagctccgagttggcttcttc
accaccaaagctgtgacggctggggcggaactcacttttgattatcagttccaaagatat
ggtaaagaggcccagaagtgtttctgtggagctcctagctgccgaggtttaataggtgga
gagactcgggttagtgtccgagcagcaggtgggaagaaacagagggaccgctcacggaag
aaagacactgacagtgcacttaccacgttggatgaagagctggaggctctgcaggagaat
ggagaaggcttgtgcggagagaaagatgtgatctcactctgcaggctcatggtgcgagtg
gagacaatggagcagcgactcacctgccttaaactcattcagaatacccagaatcccttg
tgcctgaagcagtttttggatcaccacggcctctcgctgctgtggatatttatggttgaa
ctttctgaggctaagagcaactctgtaaacaacattaaactacagctggagataatgaag
gctctggcagtgcttcccatctcaacgaagaatatgctggaggagagccgagtgctgcag
tttatccagcgctgggctcaaagccggccactcagccaaccagcagaacaggatggctac
tccagtgagagcacctcacgtgcccaaacgcccctcaacacccctgatggtccaccagcc
aagctggcttctgagctggatggggacacttccaagcgagcagtctaccataggttgaag
atcatcagtgaaaacagtctggacagtgccatgtccgatgctagtaaagcttcggatggg
aaagaagaggaggatgaggaagaggaagagatggaggatgagacttcacagttggaagcc
acaattgaaagggaggttaaagtagaaaacagtgaagcgccttctgagagtcaagctgag
cttgagcccgaattgaaacaggagccccctgaaaccgaagaagtcacacattcaacacca
gaggccactggcagtgagggagagacacttgaaacacaagaacctgaagaaaaacacatc
gttaagcctgaagaacaactggaggatgaaaggatcgtggaggagaccaagagcgaggag
ccatcagagtcccagacagagtcaacaacagttgaagatgccccttcagtcacggacacc
acatctgcagcggacattagtaatgatgtagttgctgaagtggaaactcccatggctgag
acacaggtggaaaacgcatcttctgaacaatgcagctccgaagggaatgaaagttgcagc
actgcagaaatcacacccacacaaccatcggaaactataatggagagcgtatcctctgaa
tctacagctgttgccatagagagcgcacccacagaatctccgtctgcctctgtggaaacc
actccacctgaatctgctgctgtttctactgaaaacgtatcatcagaggctgtcgtagct
gccggttctgctgatgcgtcggccctggctattgttgctgttccagcagagggtgctgca
gtggggacgccctctcaagatgaggaggaaggtgtctctgatgtggagagcgagcgcagt
caggagccacaagttcaggcttctgatatcagtgacatggccgcccggctgctggacagt
tggaaagacttaaaggaagtttacaggataccaaagaagagccaggttgaaaaagagtca
agtgatcgcagtcgtgatcgagaagccctgatgacccctcgcacaccttcgagcagtcga
gagagagagcgagaaagagataaggagcgcgatcgagaccgggaccgggacagagactgg
gagcgtgagcgggaccgggagagggatggagagagatcgtctcttcgcagtgcagataga
aaaagacgacgaggctccacctcccctctaccgccttcagcctatgagaggggccgcaga
aatgatgaccgttatgagcagtccagcagcaagaagaaactccacaccaaagagtctcgt
aacaagctgtctactgaggaacgacgaaagctctttgagcaggaagtggctcagcgggag
gcccagaaacaacaacagcagcaacagcaacaacaacaacaacaacagcagcagcaatta
cagactcttgcatttaacccactggcctacacctccagtccaaacttcatcgcctacccg
cctggataccctatccagacctacgtggatcccaccaatcccaatgcaggaaaagtgctt
ttgcccacacctgctgtagagcctctttgtgtcaccccagctcctggtacattcgaacaa
acacctactcagcctatcatatcagagctcaatctagcttcaccctcttccaccaccacc
caggccggacctgcctccagcttggcacatatccctgcctctctggagctttcctctggc
acacagactcagcagtttgtccagcctgctgtgccggcacaggacccgaacatggctgtc
ctgtcggtgcctacgcaaacagccagcccacagatccagggtcagcagggttacaccacg
ctctgggaccccaacacacagcaagcggtcacggtacagacgcagccaacccagcagtac
tccaccacggcacagcctcagactgccatctactatcagggccagccctgccagaccatc
tatagcattcctgcaggctacccacaaaccaacactcctgtcatacagacatacactgag
ccaactgccagttacctacatgggcagcaggtgtacacgggtcatcagcagggtgtggtt
gtgcagcagggaggcacggtcaccaccatcgtcacatctcagacagttcaacaggaaatg
atcgtacccaacagcatcattgatctaccgcccccttcccctcccaaacctaaaaccatt
atcctgcctcccagttggaaagtggcgcgagacccagagggcagaatctattactaccac
atcatcaccaggcaaacacagtgggatcctcccagctgggatgggactacagatgaagcc
agtgtagaacacgaggctgagatggacctcgggacgcccacatatgatgaaaatccttca
aagttctctacaaagaccgccgaggcagacacgtccagtgagctggccaaaaaaagcaaa
gaagtcttccgcaaggagatgtcacagtttattgtgcaatgccttaatccgtaccgcaag
ccagactgcatgctgggccgtatcagtaacacagaagacttcaaacatctcgctagaaag
ctgactcatggggtgatgaacaaggaactgaagtcttgcaagaaccccgaagaccttgaa
tgcaatgagaacgtcaaacacaagaccaaggagtacatcaagaagtacatgcagaagttt
ggcgctgtgtaccggcccaaggaagacatagagctggactaa

DBGET integrated database retrieval system