KEGG   Sinocyclocheilus rhinocerous: 107745109
Entry
107745109         CDS       T04916                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107745109
   04068 FoxO signaling pathway
    107745109
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107745109
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107745109
NCBI-ProteinID: XP_016414435
UniProt: A0A673LF68
LinkDB
Position
Unknown
AA seq 182 aa
MSNVRLSNGSPTLERMEARLSDQPKPSACRNLFGPVDHEELKKDFQRQLKAMEDASADAW
NFDFSTHTPHTDGRYQWDALDIRSVPGFYSRSVRAKGSDLHMCSSGNNIDKNVDVNGNHD
CRVTEQSAETPEKDREQRKRSSCLDSSCQSKRSHICVDEVTRTPRKPKKPRKHPSPTLTQ
AQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtccaacgttcgcttgtctaacggcagcccgacgctggagcggatggaggcgcgactg
tcagaccagcccaagccgtcggcgtgtcggaacctgttcggtccggtggatcatgaagag
ctaaagaaggatttccagcggcagctgaaggcgatggaggacgcgtcggcggacgcgtgg
aacttcgacttctccacgcacacgccgcacaccgacggcagataccagtgggacgcgctg
gatattcgctcggtgcccggtttctacagcagatcggtgcgggcgaagggctccgatctt
cacatgtgctcctctgggaataatatcgacaagaatgtggatgttaacggcaatcacgac
tgtcgcgtaacggagcagagcgcggagacgcccgaaaaagaccgagagcagaggaaaaga
agctcctgtctcgactcctcgtgtcaaagcaaacgctcacacatctgtgtggatgaagtg
acacggacgccgagaaaacccaaaaaacccagaaaacaccccagcccgacacttacacaa
gcccagtga

DBGET integrated database retrieval system