KEGG   Sinocyclocheilus rhinocerous: 107745205Help
Entry
107745205         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2B-like isoform X1
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107745205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107745205
   03036 Chromosome and associated proteins [BR:srx03036]
    107745205
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107745205
Transcription factors [BR:srx03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    107745205
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107745205
   HMT complexes
    MLL3/MLL4 complex
     107745205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 107745205
NCBI-ProteinID: XP_016414544
LinkDB All DBs
Position
Unknown
AA seq 3762 aa AA seqDB search
MMAAAGCGSATAAAIVGAGGVGAARGRFPGRPWLSRSRLRSEKRWQLGRSGTDLDEISSN
GGPRPTCLVLAPNEDQSHLRLLGLEASYKSLGEAGYSSSGSEEGAEFKGFEVQDENSSTL
VCAGRNACKRVRVSAKSSKRMRQRRSLPVSPLVESTGSQDSQNDSGSVQQIHSQESLKDT
SVDDDGDGDGGLGKRTRRKRGSTKQETQSTPRITIKLVAKKKVVTVPSVQRKSGKKQKEI
KSEVTESQCAQISSAHLKLKTNVPASECSAGEAKEEVCTRRRGRSADKKSESTPQTNPEK
EANDQKLKLRKSTRRSQNPLPSESIEPKSDEKSAQEGLEVNKLVIRRQSRRSSNVPQESG
DQSLAESLLEVSTIDESRPPSKKKKDKKKKKKKNCKESERKKEPHSPSAKDLGPSSDDPQ
KLAFDSDFVGIPGLRLTRIRNPKTRSRKKRCKFVWTLTLVKRKSKNSQIQENLSKTQESK
SNDSQVQDDLSKTQEIKSQDSQVHESPSPSTEAELPAKCDEEVDVSTESQSTSAPSNVSE
TGSSQESQNVENTASAVIPESPENPVAIEKVEETPEKENEEVLERSEIATEAHPEEATQT
DPEDPISRDTVPPLQIKVVSSPGKNNSLKQSFLIQQVTKSPEIKEPAKDHQHSEKSENVL
EMTATTPDPKVRKSLRQNTARKKRAKHKHWTIYRRKCRLNASQENPASESATETESQIEQ
STVSPTAVPAPVESKPKRHSSKVTHKKVKRSFPPTAEPLPEAAEMQVIEQTVESPPTKPF
LETEPQPEIKLETPSIEAEEVLVLEPSIKDQPQVLRPSRRRIKRVKRRRKSLIGRRNKNS
KSLKKELVEVSEDRPPMAGSEVEEPNLVGIFSTKYKRKRISSLQSLEGRRKKAKLLSKQL
KNTNGDQLSDQAEKDSMKTDGDQDIQHSKTKFMKTIRHFIMPVVTARSSRVIKTPKRFMD
DLGMSDLPRKNSEKKKLGLQPKSKKRDSSEKGEPGSLQSQDEDTVLSEADLDLSSTWKSK
PKSPDDAEIFSEEKQPGKRRSLLRDPGFKWGVLKPASDDVYTFDEDLDKELETLLSAKDF
TVDSFLDPVQKKKKSTKFKTQSSKFRLYKKLKLKQSLARPKKTPKDKMDKVVSSPAKTEK
KELEEGASLIKSLRDMKKEKAKLKIEDLNTPGVVRKVSICVRALSAKLLAQHQAKDIQKD
DLPDEFSIHTDISLPNKCKDFDEMHLKESKAPVSEDTQKTAVDIEEKTATQRPRLTGANK
RMFNLLKKARVQLIKIDQQKQLKSSGLLPEGRITATKRQRRKPKERLENACPNKTEASPE
PEPARGGPRIKHVCRAAAVVLGQPRAMVPDDIPRLSALPLHERSDISPSPAEKGVESHSD
PESPVLQEHKTPKFRRGRAHLLRNRSRRCGECKGCLHEEDCGRCINCLDKPKFGGPNTKR
QCCVYKRCDQVEERKALRLSGKLQKGHMKKRRSSISAGHSSNEEGEGGDGIGRTFPASLG
DSPSVRKQPRRHVKPRSYCDLLDYDSDFDWIGGSNSTSPARRRTPGLRNSDFLSFDDFVG
DAFDEGVRHRRPSFHKVPPIKRKVEKSPQEQTPPSVLAALANGFAEREQQPAEPTYKICV
DFKEDCSVQSVWATGGLSILSSVPLVPQYVCLLCASKGQHEMLYCQVCCEPFHRFCLDPS
ERPLEENKENWCCRRCKFCRVCGRKNKESKPLLECERCQNCYHPACLGPSYPKPNKRKKP
WVCMTCIRCKSCGVTPGKSWDTEWNHDKGLCPDCTRLFDQGNYCTMCFKCYEDNDYDSQM
MQCSSCSHWVHAKCEGLTDDLYEILSSLPESVVYSCQPCLQELPDREDVNGAGWRELLDQ
ELKTGLDRVLSCLLSSTFTKHLVTCKKCTTMGSPNTVVEDLPVCDFRAIGKKFDEGLYTS
LKSFHEDVVKVIRHHLEDEEILPEDQRPTALARSYYLKLLEEIYGWFNSQDPKIWDPRSI
HLPAGMLSHAVMPPNYEHVYAQWRERDGCSKALDGAPQMTGRHMGVKMGEEEDLSTPLAH
NPKGHFMDMRALRMNLKGKKGRPAKSDLDTGWPKDDERQCSLCQKYGDAKASDAGRLLYL
GQNEWAHVNCTMWSAEVFEEDNGSLLHVHSAVARGRLMRCERCNRTGATVGCCLTSCQSN
YHFMCARFRNCVFQDDKRVFCYKHRDLISGKIITGQGFEVLRRVYVDFEGISLRRKFLTG
LEPESINLMIGSLLVKKLGKLSELSACHGKLFPVGYECSRWYWSTVNPLRRCKYTFRVRE
VRSPVQEKPVEESPDQGENCTIAHSPCPQSETEALGGDLSLTNPSTETNSTLVSVFAKPD
LGARPKIPSYPQNRRPAGGLSRPLPSPGAAPSKPHHILTISDLEDTRRTRRHSPHTQNSG
TRSHMASPTLGSPAGPIASRAGGSHHPKTSQPTSPGFPLGATENLLTSSSARPVGRSASS
VRGSGILTPHSTSGLFSQSTRQGGIGSTPCTNRSLTSPTHLSTRPRPFDFNQIDSVELPH
NFIASPQEHPGENGALPLGDPLGTQKGNHLGSDGDFPYTSFHLEADLTVAPELRTELEIE
ETELNEGVAMNCSAQIVVEGEDNQEDFWEPDEEKSKMSTQRSSCTVDPCREHWGNSSSDE
DMENYFNFTRTVVTCKAQRDASQTSTSPSLRQISQLDGVDDGTESDTSVANNENQGVKLS
NQAQKPHKPFNAVPHEQTASNGLCLAFPSPVSDFSLIRLEPMFNSETVADQDSFGVMQTL
QSSQDSLTNFVDQKPSNTAFSTYGNDYQTPHLMVEPETPLILERCDPLSPNAHFTELVPV
QDSPNDPQDSKELYLDPSSGHFVSSMNVSTVYQNNHLHEDSLDLMEVNGIQIPQQQNPGP
STVFTKSASSSDSSAQVSFATFPNQAPSANVSLYPVQTPEGKTVLPPMESFRTKLHPPAE
PRHPAPSVPGGAMPRIPTNLPQKPESMLSVPSATGVPLGTYGPVLGTVSVPLHPTYPQPI
GSTTVGMISSSVTSQPSAQCHSMPSAIQPASAPGVINGYNTTPMQRETAPGRTISINFST
PRSTVEPQQQLVTQALPGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPESNTFQLP
TLNSPSYNCVTQIASLLQSNALSATLAAAGNLSPVAGVTIPTQVSQIVTPLVQTSNTITQ
LLATSTNGAASLPADAKKSRRSAKASGDRVKKPRNKKESSTPRRTKSASTHGPSSKQSTS
QITTSSDTSNQAESAQAIINQAMAGYYDPNKTVSLIPSSPRNSTVVGRTQTTSSVVLPEG
LLVESEIKSSPPATPEAAPRPKQVRMKRVSSLSDRIATKKSKSDFLDLDRPSGLEEPRKS
NSVSARYGVRIKTPTVKGILDLDKLNEERISDSESARPGPWDRLSLPRGGDSNKPATWDP
ANRNALSDWNKYSGMLSCSDDEMPPSDGEEHSPPSRDQPHLRFEIASDDGFSVEADSIEV
AWTAVIKGVQEARAVAGLRQLTFSGMSGVRVMGMLHDAVVYLVEQLQGANRCHRHTFRFH
KQASQEEDLPVNPSGCARSEVYLRKSTFDMFNFLASQHRQLPDTDLYDEEEDEVLLKSTR
RATSLELPMAMRFRHLEKTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVL
TDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIV
IFALRKIYRGEELTYDYKFPIEDASNKLGCNCGAKRCRHFLN
NT seq 11289 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcagcgggatgcggatcagcaaccgcggctgccattgtgggcgcaggcggc
gtgggcgcggcgcggggtcgcttccccggtcggccttggttgtcgcggagccgtttgcgt
tcggagaagcgatggcagctcggccgctctgggacagatctagacgagatctcctccaac
ggaggcccgaggcccacctgcctggtgctcgcgccgaacgaggaccagtctcacttgcgc
cttctcgggcttgaggcgagctacaagagcctgggagaggctggatacagctcgagtggg
agcgaagagggagctgaattcaaaggctttgaagttcaagatgaaaatagcagcaccctg
gtttgcgctggacgaaatgcatgtaaacgtgttcgtgtttcagcaaagtcgtcaaagagg
atgcgtcaaaggcggtctcttccagtgtcccctttagtagaaagcacaggttcccaagat
tctcaaaatgattcaggttctgttcagcaaattcacagtcaagagtccctaaaggacaca
tcagtagatgatgatggtgatggtgatggaggattggggaagcgcaccaggagaaaaaga
gggtcgacaaaacaggagacccagtcaactccaagaatcacaatcaagttggtggctaaa
aagaaagtggttacagtcccatcagtgcaacgtaaatctggtaaaaaacagaaggaaatt
aaatctgaagttaccgagagtcagtgtgcccaaatctcaagtgctcatttgaaattaaag
acaaatgtaccagccagtgaatgcagtgctggtgaggcaaaggaggaggtttgtactaga
aggcgaggaagatctgctgacaagaaatcagaatccactccgcaaacaaaccctgaaaaa
gaggccaatgaccaaaaactgaagctgaggaaatcaactcgaaggtctcaaaatccactg
cccagtgaaagtatagagccaaaatctgatgaaaagtcagcacaagaaggtttagaggtg
aataagcttgtgattaggagacaaagtagaaggtcctcaaatgttccacaggaatctggt
gaccagagtttagcagagtcgctgttggaggtctccacaattgatgaatccaggccacct
tcaaagaagaaaaaagataaaaagaaaaagaagaagaaaaattgcaaagaatccgaaagg
aaaaaggagcctcattcaccatcagcaaaagatcttggcccttcgtctgatgatcctcaa
aagcttgctttcgacagtgattttgtcggaattccaggtcttagactaacaaggatacga
aaccccaaaaccaggtctcgcaagaaacgctgcaagtttgtgtggactctcacactggtg
aaaaggaaaagcaaaaactcccaaattcaagagaatctaagtaaaacccaagaaagcaaa
agcaatgattcccaagtccaagatgacctcagcaaaacacaagaaatcaaaagccaagat
tctcaagtccatgagagtccaagccccagcacagaggcagaacttcctgctaaatgtgat
gaggaagtagatgtttctacagaatcacaatccacatccgctccttccaacgtttcggaa
accggttcttcacaggagtcacaaaacgtagagaacactgccagtgccgtaattcccgaa
agcccagagaaccccgtggccattgagaaggttgaggagaccccagaaaaggaaaacgag
gaggttcttgaaaggtcagaaattgcaacagaagcacatccagaagaggccactcagaca
gacccagaagatccgatcagtagggataccgttccaccacttcaaatcaaagttgtctcc
tcaccaggtaaaaataacagtctaaagcagtcctttttaattcagcaagtcacaaagtca
cctgaaataaaagaacctgcaaaagaccatcagcattcagagaagagtgaaaatgtgttg
gaaatgactgctaccactcccgaccctaaagtaaggaaaagcctacgtcaaaacactgct
cggaagaagcgtgcaaaacataaacactggacaatttacaggcgaaagtgtagattgaat
gcatctcaagaaaaccccgcttctgaaagtgcaactgaaaccgaatctcagatagagcaa
tcaacagtatcaccaacagcagtgccagcgcctgtagaatccaaaccaaaaagacattct
agtaaagttacgcataaaaaagttaaaaggtcctttccaccaactgcagaaccattacct
gaagcagccgaaatgcaggtcattgaacaaactgttgaatcacctccaaccaaaccattt
cttgagacagaaccccagccggagataaaacttgagacaccatcaatcgaagctgaagag
gttctagtattagagccttccataaaggatcagccacaggtacttcgtccttcacgtcga
cgaataaaacgggtcaaacgaagacgaaagtctctgattggacggcggaataaaaattca
aaatcgctaaagaaggagttggttgaggttagtgaagatcgtccaccgatggcgggctct
gaagtagaggagcctaatctagttggtatattctcaacaaagtacaagaggaaacgaatt
tcgagtcttcagtcattagagggtagacggaaaaaggccaagctcttatcaaagcaactg
aagaacaccaacggagatcaactttccgatcaggcagaaaaagattctatgaaaacggat
ggagatcaagacatccaacacagcaaaacaaaattcatgaaaaccatcagacatttcata
atgccagtcgtgactgcccgatcctctcgggttatcaaaaccccaaagaggttcatggat
gatcttggtatgtcagaccttcctcgcaagaactccgaaaaaaagaagcttggtctacaa
ccaaaatcaaagaaacgtgattctagtgaaaaaggtgaacctgggtcccttcagtctcag
gatgaagacactgttttgagtgaagctgatcttgatttgtcttccacttggaaatcaaaa
cctaaatcgcccgacgacgctgagatcttcagtgaggagaagcagcctgggaaaagacga
tcgctactccgagatcccggtttcaaatggggagtgctgaagcctgccagtgacgacgtg
tataccttcgatgaagatcttgacaaggagttggagaccttgctatctgccaaagatttt
acagtggactcgtttcttgatcctgtccaaaagaagaagaaatccacaaaattcaaaacg
caatcatcaaaatttaggttatacaaaaagcttaaactcaaacagagtctcgcaaggcct
aaaaagaccccaaaggacaaaatggataaagttgtgtcatcccctgccaagacggagaag
aaggagttggaagaaggggccagtctaataaagtctctcagagacatgaagaaggaaaaa
gcaaaactcaagattgaggatctcaacacccctggggttgttcgcaaagtctccatctgt
gtacgagctctgagtgccaagttgctggcgcaacaccaggcaaaagacatccaaaaggat
gacctgccagatgagttctccattcatacagacatctcacttcccaataaatgcaaagac
tttgatgagatgcatctcaaagaatccaaagcaccggtttctgaggacactcagaaaact
gccgttgacattgaggagaaaaccgccacccagcgccctcgccttacaggagccaacaag
cgcatgttcaacctgctcaagaaagccagggttcagctcatcaaaatagaccagcagaaa
cagctgaaatcatctgggctcttgccagagggtagaatcactgcaacaaagagacagaga
cgaaaaccgaaagagcggcttgaaaatgcctgtcccaacaagactgaagcttctccagag
ccggagcctgccagaggagggcctcgcattaagcacgtatgcagagctgcagctgtggtt
ttgggtcagcctcgtgccatggtccctgacgacatccctcgactcagtgcactacccctg
cacgagagatcagatatatccccttcacctgcagaaaaaggagtcgagtctcactctgac
ccggaaagccctgtgttacaagaacacaagacacccaagtttcgccgtggtagagctcat
ttgcttcggaaccggtcccggcggtgtggggagtgtaaaggttgtctgcatgaggaggac
tgtggcaggtgcataaactgcttagacaaacccaagtttggtggcccaaacacaaaacgg
cagtgctgcgtatacaagagatgtgatcaggttgaggaaaggaaggccttgaggctaagt
ggcaagcttcaaaaagggcacatgaaaaagcgtcgctcgtcaattagtgcgggtcactca
agtaatgaagaaggtgagggcggcgatggaatcgggcgaacgtttccagcctctctgggt
gacagcccatctgtgcggaaacagcctcgccgacacgttaaaccacgttcctactgcgac
ctgttggattacgactccgactttgactggataggaggatcaaattccacctccccagcc
cgcagaagaactcctggccttcgcaactcagattttctgtcatttgacgacttcgtcggc
gatgcctttgacgagggagtgcggcatcgcaggcctagcttccacaaggttccacccatc
aaacggaaagttgagaagagccctcaggaacagacaccgcccagcgtccttgcagccctc
gccaatggttttgcagagagagaacagcagcctgcagaacccacatacaagatctgtgtt
gattttaaggaggactgtagtgtccagagcgtgtgggcgacaggaggtttgagcatcctc
tcttctgtacccctcgtgccccagtatgtttgcctgctgtgtgccagtaaaggccaacat
gagatgctgtattgtcaagtctgctgtgagcctttccatcgcttctgcttggacccttca
gagcgccctctggaggagaacaaggagaactggtgctgtcgtcgctgcaagttctgccga
gtttgtggacgcaagaataaagaatccaagccgctgttggagtgtgaaaggtgtcaaaat
tgttatcatcctgcctgtctgggtcccagctatcccaaacccaacaaacgtaaaaagcct
tgggtctgtatgacatgcatccggtgcaagagttgtggtgtgaccccaggaaagagctgg
gacaccgagtggaatcatgacaaggggctgtgtcctgactgcactaggctgtttgatcaa
ggtaactactgcaccatgtgcttcaagtgttatgaagataatgactatgatagccagatg
atgcagtgctcctcgtgtagccactgggtccatgctaaatgtgaaggtctgacagatgac
ttatatgaaatcttgtcgagtctgcctgagagcgtggtgtactcctgtcagccgtgctta
caagagctgcccgatagagaggacgttaatggagcaggttggagggaactgcttgaccag
gagctcaagactggcttagatagggtgctgtcttgcctgctgagctccaccttcactaaa
cacctggtcacctgcaagaagtgcactacaatgggttcccccaacactgtggttgaagac
ttgcctgtctgcgacttccgtgctattggaaagaagtttgatgaaggcctgtacacatcc
ttgaaatcctttcacgaggatgtggtgaaagtaattcgccatcacttggaagatgaggaa
attctaccggaggaccaaagacccactgccctcgcccgctcatattacctgaagctctta
gaggaaatttatggttggtttaacagtcaggaccctaaaatatgggatccacgctctata
cacctgccagctggaatgctttcacatgctgtgatgcccccaaattatgaacatgtttat
gcacaatggcgtgagagagatggctgtagtaaggctttggacggcgccccacagatgact
ggaagacacatgggtgttaaaatgggagaagaagaggatctgtccacacctttagcccat
aaccctaaaggacactttatggacatgagggcgttacgaatgaatctgaaagggaagaag
ggtcgaccagctaaatctgacttagacacaggttggccaaaagacgacgagagacagtgc
tctctgtgccaaaaatacggtgatgctaaggccagtgatgcagggaggttactctatcta
ggccaaaatgaatgggctcatgtaaactgcaccatgtggtctgcagaggtgttcgaggag
gataatggctcacttctgcatgttcacagtgctgttgcacgaggccgtctgatgcgctgt
gaacggtgtaaccgaactggggcaacggtaggttgctgccttacttcgtgccagagcaac
taccacttcatgtgcgcccgctttcgcaactgtgtcttccaggatgataaaagagtcttc
tgttacaagcatcgtgaccttataagtggaaaaatcatcactggtcaagggtttgaagta
cttcggagggtttatgtggattttgaagggataagtcttcgcagaaagtttttgactgga
ttggagccggagtcaatcaatttaatgataggttctttgcttgtaaaaaagctgggaaag
ctgagtgaattatctgcctgtcatggaaaacttttccccgtgggttatgaatgctctcgc
tggtattggagtactgtaaacccccttcgtcgatgcaaatacacatttcgtgttagggag
gtccggtcacctgttcaggaaaaaccagtggaagagtcgcccgatcagggagaaaattgc
acaattgcccatagcccatgcccccagtcagaaactgaagccctgggaggggatttgtct
ttaacaaatccatccactgaaacaaattccaccttggtatctgtatttgccaaaccggac
cttggtgcccgccccaaaatcccttcatacccccagaacagaagacctgctggaggacta
tccagaccactgccttctccaggagctgccccatccaaacctcaccacatcctgactata
agtgatttggaagacactcgaaggacacgacggcatagcccacacacccagaatagcggt
acccgcagtcacatggcctcccctactcttggatcccctgcaggcccaattgcatctaga
gcaggtggttcccaccaccctaaaacctcccagcctacctccccaggtttcccccttggt
gctactgaaaacctgctgacctcttcatcagctcgtcctgtcggtcgaagtgcttcctct
gtccggggttctggaatattgacgccccattctacctcaggactgttttcacagtccaca
aggcaaggtggcattggcagcaccccttgcaccaaccgatctctcacctctcctacccac
ctctccacaagaccaaggccttttgattttaatcagatagactccgttgaacttccacac
aattttatagcatcaccacaggaacatccaggagaaaatggtgccttgccattaggagac
cctttgggtacacaaaaaggtaatcatctaggcagtgacggggatttcccttacacatcc
ttccatttagaggcagacctgactgtggcacctgagctgagaactgagcttgaaattgaa
gaaaccgagctgaatgaaggcgtagctatgaactgcagtgcacaaattgtagttgaaggt
gaagacaaccaggaagacttctgggagccagatgaagagaagtccaaaatgtctacccag
agatcgtcttgtactgttgatccttgtagggaacactggggtaatagttcttctgatgag
gacatggaaaactacttcaacttcactcgcacagtggttacttgcaaggctcaaagggat
gcctctcagacatctacatctccatctttaaggcagatttcacaacttgatggtgtggat
gatgggacagagagtgatacaagtgtggctaataatgaaaaccagggtgtgaaattgtca
aatcaagcccaaaagccacacaaaccattcaacgctgtgcctcatgaacaaacagctagc
aatggtctgtgtttggcatttccaagtcctgtttctgatttttctttaattcggttagaa
cccatgttcaactcggagactgttgctgatcaagattcttttggtgtaatgcaaacattg
caatcaagccaagactctttgacaaatttcgttgatcaaaagccttcaaacactgcattt
tctacatatggtaatgattaccaaacccctcatttaatggttgaaccagagacaccctta
attcttgagagatgtgatcctctttcacccaatgcacatttcacagagttggtcccagtc
caggattctccaaatgacccacaagactccaaagaattgtacttggatcctagtagtggc
cactttgtgtcgtcaatgaatgtctctacagtttaccaaaacaaccacttgcatgaagat
tctcttgacttaatggaagttaatggaattcagattccacagcaacaaaatcctggtcct
tccacggtgtttaccaagtctgcatcatcttctgattcctctgcacaagtttcttttgca
acattcccaaatcaggcaccatctgcaaatgtttccttgtaccctgtccaaactcctgag
ggtaagacagtcttgccacccatggagagtttcagaaccaaattacacccacctgctgaa
ccaaggcatcccgccccttcagttcctggaggggcaatgccacgtattcccacaaattta
ccacagaaaccagagtcaatgctgtctgtgccatcagcaactggtgtacctcttgggact
tatgggccagttttgggtacagtgtctgtcccattgcatcccacttacccacagcccatc
ggctctacaactgttggcatgatctcctcctctgtaacttctcaaccatcagctcagtgc
cattcaatgccttctgccattcagccagcctctgctccaggtgtcatcaatgggtacaac
accacacctatgcaaagagaaactgctccaggtcgaacaatttccataaatttttcaacc
cccagatcaacagttgaacctcaacaacagttggttacccaagcattgccaggtcatgct
attcttaccgtaaaggaggttggtggacctaatgtggatcctacaccacatgttttactt
gttaatcgtcttggtcaaatatttgtcaaaaaccctgaaagcaacaccttccagctgccg
actctaaattccccttcatataactgtgttactcaaatcgccagccttttgcaaagcaat
gccttgtctgcaacacttgcagcagctgggaacttgtccccagttgcaggtgtcaccatt
ccaacccaagtctcccaaattgtaactccattggtacagacctccaacaccattacccag
ctacttgccactagtactaacggagcagcttcactaccagcagatgctaagaagtcacgt
aggagtgccaaagcttctggagatagagtgaaaaaaccacggaataagaaggagtcttcc
acacctagaaggacaaagtctgcaagcacacatggcccctctagcaaacaatctacgagt
caaataacaacctcctcagatacatcaaatcaagcagaaagtgcccaagctatcatcaac
caagctatggctggatattatgatcccaacaagactgtttccctaattccctcatcacct
cgtaacagtaccgttgttgggcgaactcagacaacaagttcagtagttttaccggaagga
ctccttgttgaatcagagataaagtcttccccaccagcaacaccagaagcagcacctcga
ccaaaacaggttcgaatgaaaagagtgtcctctttatctgaccgtatcgccaccaagaaa
tcaaaatctgactttttagacctggaccgccctagtggattggaagaaccacgcaagtca
aactcggtatcagcaaggtatggagttcgcattaaaaccccaactgtcaagggaattcta
gacttagacaagctgaatgaagagcgaattagtgactctgagagtgcaaggcctggacct
tgggatcgtctttcattgcctcgtggtggagacagcaacaagccagcaacctgggatcct
gctaaccgtaatgcactgtctgactggaacaaatactcagggatgctgtcttgttcagat
gatgagatgcctccatcagatggggaagagcatagtccacccagccgagaccagccccac
ctacgctttgagatcgctagtgatgacggcttcagtgtagaagcagacagtattgaggtc
gcttggaccgctgttatcaagggagttcaggaggcccgtgctgttgctggactgaggcag
ctcactttttctgggatgagcggggtgcgtgtgatgggaatgctgcatgatgctgtagtc
tacctggtggaacagctccagggtgccaatcgctgccatcgccacaccttccgcttccac
aaacaggccagtcaggaggaagatctgcccgttaacccaagtggctgtgcccgctctgaa
gtctacctgaggaagtctacctttgatatgttcaacttcctggcgtcacagcacagacag
cttcctgacaccgacctgtatgatgaggaagaggatgaggttcttctcaaatccaccagg
cgcgcaacaagtttggagcttccgatggcgatgcgctttagacatctagagaagacatcc
aaggaagcggttggtgtctacagatctgcgattcatggaagaggccttttctgcaagcga
aacatcgaggcaggagagatggtcattgagtattcaggcattgtcattcgttctgttctt
acagacaagcgtgagaagtattatgatggcaagggcattggatgctatatgttccgcatc
gatgactttgatgtggtagacgccacgatgcatggtaacgcggcgcggttcatcaaccac
tcctgcgagccaaactgctactctcgagtcatcaatgtagaaggtcagaagcacatagtt
attttcgccttgcggaagatctaccgtggagaggagctgacctatgactacaagttcccc
atagaagatgccagcaacaagctcggctgcaactgtggcgctaagcgctgtcggcacttc
ttaaactga

DBGET integrated database retrieval system