KEGG   Sinocyclocheilus rhinocerous: 107746600Help
Entry
107746600         CDS       T04916                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00250  Alanine, aspartate and glutamate metabolism
srx00410  beta-Alanine metabolism
srx00430  Taurine and hypotaurine metabolism
srx00650  Butanoate metabolism
srx01100  Metabolic pathways
Module
srx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    107746600
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107746600
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107746600
   00430 Taurine and hypotaurine metabolism
    107746600
Enzymes [BR:srx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107746600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 107746600
NCBI-ProteinID: XP_016416367
LinkDB All DBs
Position
Unknown
AA seq 586 aa AA seqDB search
MASSAPSSSAPDMDPNTANLRQPATTGDAWYGVAHGCTRKLGMKICGFLQKNNSLDEKSR
MVGAFKESAKNQMCDNSERFTRAETDFSNLFARDLLPAKNGEEPTIQFLLEVVEILTNYV
RKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFF
NQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIIGWPNGDGDALF
SPGGAISNMYSVMVARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAVLGFGKENV
ILLKTDERGRVIPTDLEAKIIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNL
WLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGILQGCN
SMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDRCLELSE
YLYNKIKNREGYEMVFEGQPQHTNVCFWYIPPSLRSMPHGDERREKLHRVAPKIKAMMME
CGTTMVGYQPQGDKVNFFRMVVSNHAVTKSDIDFLIDEIERLGHDL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctgcaccttcttcctcggctcctgatatggacccaaacacggctaattta
cgacaacctgccacaaccggcgacgcgtggtacggggttgcacacggatgcacgaggaaa
ctgggcatgaagatctgtggtttcctgcagaagaacaacagtctggatgagaagagtcgg
atggtgggcgccttcaaggagagcgcgaagaaccagatgtgtgacaacagcgagcgcttc
acgcgcgcagagacggacttctccaacctgttcgctcgagatctactgcctgctaaaaat
ggcgaggaacccacaatccagtttcttctcgaggtggtggagatcctcaccaattatgtg
cgcaagaccttcgacagatccaccaaagtgctggacttccatcaccctcaccagctcctg
gaggggatggagggcttcaacctggagctgtctgaccaaccagagtcgttggagcagatc
ctggtggactgcagagacacgctcaagtatggagtcagaacaggtcatcctagattcttc
aatcagctttcgtctggtctggacatcatcggtctggctggagaatggctcacctctact
gccaacactaacatgttcacatatgaaatcgctcctgtgtttgttctgatggagcaactg
accctcaagaagatgagagagatcattggatggcctaatggtgatggcgatgcactcttc
tcaccaggtggtgccatatcaaacatgtacagtgtgatggttgcgcggtacaagtatttc
cctgaagtcaaaaccaaaggcatgtctgcagcaccacgactcgtgcttttcacttctgaa
catagtcattattcaatcaaaaaggcaggagcagtgctgggatttggcaaagaaaacgta
attctcctgaagacagatgagagggggcgtgtcatacccactgacttagaggccaagatc
attgatgccaaacagaagggttacgtgccactgtttgtgaacgcaacagctggtaccaca
gtatatggagcattcgatcccatcaatgacattgccgacatctgcgagaagtacaacctg
tggttacatgtagatggtgcttggggtggaggactgctgatgtccaggaaacaccgtcac
aagttaagcggcattgagagagcaaactcagtcacatggaaccctcataagatgatgggt
gtaccactgcaatgttcagccatcctggttagagagaagggcattctgcagggctgcaac
tccatgtgcgctggatacctcttccaaccagacaaacagtacgatgtgacctacgacacc
ggcgacaaggccatccagtgtggcagacatgtagacatcttcaaattctggctcatgtgg
aaggccaagggcacagttgggtttgagcagcacattgacagatgtctggagctttctgaa
tatctctacaataaaatcaagaaccgtgagggatatgaaatggtctttgagggccagccc
cagcacacaaatgtttgcttctggtatattccaccaagcttgcgtagcatgccacatgga
gacgaacgaagggagaaactacacagggtggcgccgaagatcaaagcaatgatgatggag
tgtggcacaaccatggtaggataccaaccacagggagacaaggtcaacttcttccgaatg
gtcgtctccaatcacgccgtcaccaagtccgacatcgatttcctcatcgatgagatcgag
aggctgggtcacgacctgtaa

DBGET integrated database retrieval system