KEGG   Sinocyclocheilus rhinocerous: 107746943Help
Entry
107746943         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107746943
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107746943
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107746943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 107746943
NCBI-ProteinID: XP_016416782
LinkDB All DBs
Position
Unknown
AA seq 724 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRMLTEDVSSLTEVNSVYIVQEYMETDLCKVLE
QGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILQSIPVVHEEDRLELQSVIPVFIKNDMSEPHTPLTKLLPGVSPEALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDESHSHIYNWDRYHES
QFSDQDWHLHSTHELEDVQRDPRAMSDGTDEEEVQIDPRKYMDGECEKFLEDPSFDLPPE
RSWQQEDHHENKYCDQECSYTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKEQ
QSKEKNDKKGKTKCEKNGLVKAQIALQNHCVAEKDHVQEKHQNHNQGFDFDSFIASTIKM
SLQPESGDVDLLNELNTSVSQLDTRAPCGSMSKSISQEKEEKCLVNLAQLGVQAPCPWES
FTDSDVTESSIIDEACWDVRKDEQLQKENSSCQSSYLDRLFNKREEVESEIPEPVEESTL
EDDFISCGGEIVFNMQLESLAIPGFEGAGDIPLKSIQATLTPSAVKRSPQIAHKTYSSIF
KHLN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagccttatgaacattcacggcttcgacctgggccctcgctac
atggacctaaagcctctgggctatgggggcaatggactggtcttttccgctgttgacacc
gattgtgacaagagggtcgctgtgaaaaagattgtcctaaccgaccctcagagcgtcaaa
cacgcactgcgcgaaatcaagatcattcgcaggctcgatcacgacaacatcgtgaaggtg
tttgaaacgctggggcccagtggccggatgctcacggaggacgtgagctctctgacggag
gtcaactctgtgtacatcgtacaggagtacatggaaacagacctctgtaaagtgctggaa
cagggcttgttgtccgaggatcatgcacggctgttcatgtaccaactgctgcgaggactc
aaatacatccactctgcaaacgtgcttcaccgagacctgaagcctgccaacctcttcgtc
aacactgaggacctggtactgaaaattggggactttggacttgcccgtatcatggacccc
cactattcccataaggggcatctgtctgagggactggtcactaaatggtatcgttctcct
cgtctgctcctttccccaaataactacaccaaagccattgacatgtgggccgcagggtgc
atctttgctgaaatgctgactggaaaaactctctttgcaggagctcacgagctggaacag
atgcagctgattctgcaatccattccggtagtccatgaggaagacagactggagctccaa
agtgtaatacctgtctttatcaagaacgacatgtcagaaccacacacgccgctcaccaag
ttattgcctggtgtcagccctgaggccttggatttcctggagaagatcttgacgtttaac
cccatggaccggctcactgcggaagaggctcttgctcacccatacatgagcgattactcc
ttccctctagacgaaccagtgtccttgcaccccttccatatcgaggatgaggtggatgac
atcttgctcatggatgagagccacagtcacatctacaactgggacaggtaccatgaaagt
cagttctctgatcaagactggcacctgcacagcactcatgaactagaagacgtgcagcgt
gatcctcgagctatgtcagatggcacggacgaggaggaggtccagatcgatccacggaaa
tacatggatggggagtgtgagaagttcctagaggatccatcgttcgatcttccaccagag
cgctcgtggcaacaggaagatcaccatgagaacaaatactgcgaccaggagtgcagctac
acttgcaactacaaagctgtgtccccatcctacctggacaatctgatctggagggacagt
gaggtgaaccactactatgagcccaaactcatcattgacctctccaactggaaagaacag
caaagcaaagagaagaacgacaaaaaaggcaagaccaagtgtgagaagaacggactggtc
aaggcccagatcgccctgcaaaaccactgcgtggccgagaaggatcacgtacaagaaaaa
caccagaaccacaaccagggctttgactttgattcgtttatcgccagcaccatcaaaatg
agccttcagccagaatccggcgacgttgacctcctgaatgagttgaacacctccgtttcc
cagctggacacccgtgctccttgcggctccatgtccaagtccatcagtcaggagaaagaa
gagaagtgtctagtaaacctggcacagctcggcgtccaagcaccctgtccttgggagagt
ttcacggacagcgacgttaccgagagcagcataatcgacgaggcttgctgggacgtccgc
aaagacgagcagctccagaaggagaacagcagctgccagagcagttacttagaccgcctc
ttcaacaagcgtgaggaggtagagtccgagatccccgaacctgttgaggagtccacactg
gaggatgacttcatatcctgtggcggcgagattgtctttaacatgcagctggagtctctg
gccattccggggttcgagggagcgggtgacattcctctgaagtccatccaggcaacgtta
acgccctctgctgttaagcgctccccacaaatcgcccataaaacctacagcagcattttc
aagcatttaaattaa

DBGET integrated database retrieval system