KEGG   Sinocyclocheilus rhinocerous: 107748028
Entry
107748028         CDS       T04916                                 

Definition
(RefSeq) transcription factor p65-like isoform X1
  KO
K04735  transcription factor p65
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04218  Cellular senescence
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04623  Cytosolic DNA-sensing pathway
srx04625  C-type lectin receptor signaling pathway
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107748028
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107748028
  09143 Cell growth and death
   04210 Apoptosis
    107748028
   04218 Cellular senescence
    107748028
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107748028
   04621 NOD-like receptor signaling pathway
    107748028
   04622 RIG-I-like receptor signaling pathway
    107748028
   04623 Cytosolic DNA-sensing pathway
    107748028
   04625 C-type lectin receptor signaling pathway
    107748028
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107748028
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107748028
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107748028
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107748028
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107748028
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107748028
NCBI-ProteinID: XP_016418159
UniProt: A0A673KJU9
LinkDB
Position
Unknown
AA seq 572 aa
MDGLFHQWGPSPVAQGPPYVEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNESTKTHPAI
KVHNYSGPLRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGDAVSCRLQTQNNPFNIPEPRIWEEEYDLNAVRLCFQVSITLPSGELFSLEPVVSQ
PIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWESKGSFSQ
ADVHRQVAIVLRTPPYRDANLTEPVRVKMQLRRPSDRELSEPLDFQYLPADPDEHRLMEK
RKRTEGMLQNLKLSSIITGSSMPADRRPFSTAKRTLGISKPTAASSLPAAASAGVSLKPL
PQPSSFFAPAPGQLFAASAQSSPSCTSDTWKFLQSLTGDSQPKAAASAFTQDFPTVNLSD
LHDFNSFMASDQTSAEPAAEPIQSAAADDELPEFPSFSEVQGSDVDNINIEDFQALLVQS
GLPGEVGLSLGKPGSSTEPAADHAGNGSTWMSFPPSIASLIHNESMMESAAPPAPAPGVL
DDLEVLNSIDDDRFMSIFTSGHQVGFLSGHPT
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggacggactgtttcaccagtggggaccgtccccggtggcccaaggccctccgtacgtg
gagataatcgagcagccgaaagcacgagggatgcgtttccgctataaatgtgagggtcga
tccgccggcagcatcccaggagagaagagcaacgagtccacaaaaacacaccccgccatc
aaggttcacaactacagcgggccgctgagagttcgcatctccttggtaaccaagaaccag
ccgtacaagccacacccacacgagctggtgggcaaagactgcaaacacgggtattatgag
gccgacttacaggagcgacggatacacagtttccagaacctgggtattcagtgcgtgaag
aagaaggatgtgggagatgcagtttcctgtcgcctgcagacacagaacaaccccttcaat
atcccggagcccaggatctgggaggaggagtacgatctgaacgcggtgcgcctgtgcttc
caggtgtccatcacgctgcccagcggagagctgttctctctggagcccgtcgtgtctcag
cccatctatgataaccgagctcctaacacagccgagctcaagatctgccgcgtcaacagg
aactccggcagctgccgcggaggagacgagatcttcctgctgtgcgacaaagtgcagaaa
gaggacatcgaggtgcgtttcttccaggactcatgggagagcaagggctcgttctctcag
gctgatgttcaccggcaggtggctatcgtgttgcgcacgcctccgtaccgcgacgctaac
ctgacggagccggtgcgtgtgaagatgcagctgcgcaggccgtctgaccgcgagctcagc
gagccgctggacttccagtacctgcctgcagacccggatgagcacaggctgatggagaag
cgcaagagaacagagggcatgctgcagaacctcaaactgagcagcatcatcacaggatcc
tccatgcctgcagaccgacggccgtttagtaccgctaaacgaacactaggcatctctaaa
cccacagccgccagcagcctcccagcagcggcgtctgcaggtgtgtcgctgaagccgctg
ccgcagccgtcctcgttcttcgctcctgctccgggtcagctgttcgccgcgtccgctcag
agttcaccgagctgcaccagcgacacctggaagttcctccagagtctgacgggagactct
cagcccaaagctgcggcgagcgccttcacgcaggacttccccaccgtcaacctgtccgac
ctgcacgacttcaacagcttcatggcatcggatcagacgagcgccgagcccgccgctgag
cccatccagagcgccgccgccgacgacgagctccccgagtttcccagcttctcggaagtg
caaggctccgacgtcgacaacatcaacatcgaggatttccaagcgctgctggttcagagc
gggctccccggggaagtgggactctcgctggggaagccgggaagctctacggagccggcg
gctgatcacgcggggaacggctccacgtggatgtccttcccacccagcatcgccagcctc
atacacaacgagagcatgatggagagcgcggctcctccggctccggcccccggcgtcctc
gacgacctggaggtgctcaactccatcgacgacgaccgcttcatgtccatcttcaccagc
ggccaccaggtcggattcctgtctggtcaccccacctaa

DBGET integrated database retrieval system