KEGG   Sinocyclocheilus rhinocerous: 107750677
Entry
107750677         CDS       T04916                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107750677
   04068 FoxO signaling pathway
    107750677
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107750677
   04115 p53 signaling pathway
    107750677
   04218 Cellular senescence
    107750677
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107750677
NCBI-ProteinID: XP_016421665
UniProt: A0A673I6H4
LinkDB
Position
Unknown
AA seq 145 aa
MAMHKRILRALGNIPTRRNLFGPVDREQLQLEYRDALRKDLEEASRRWSFDFVSETPLEG
GDFQWEWVSGEKVPVLYRACQEGKHPRLRVGKENIPRTPERFSAVPQDVEKTPEKSTELK
RKQTNITDFYQAKKRAVDTPRKSGQ
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcgatgcacaagcggatcctgcgagctctcgggaacatcccgacgcggcggaacctc
ttcgggccggtggatcgcgagcagcttcagctggagtaccgcgacgctctgaggaaggac
ctggaggaagcatcccgccgctggagcttcgacttcgtctcggagacacctctggagggc
ggagacttccagtgggagtgggtgtccggggaaaaggtgcccgtcttgtaccgcgcctgt
caggagggcaagcatccgcggctgcgcgtgggtaaagagaacatccccagaaccccagag
agattcagcgctgtcccgcaggacgtggagaaaacgccagaaaagagtacagagctgaag
aggaaacagacgaatatcaccgatttctaccaggcgaagaagagagcggtggacacaccc
cgcaaatcaggacaataa

DBGET integrated database retrieval system