KEGG   Sinocyclocheilus rhinocerous: 107750777
Entry
107750777         CDS       T04916                                 

Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107750777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107750777
Cytokines and growth factors [BR:srx04052]
 Cytokines
  CSF and other factors
   107750777
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 107750777
NCBI-ProteinID: XP_016421789
UniProt: A0A673IMI5
LinkDB
Position
Unknown
AA seq 183 aa
MFHGSGLFALLLMVLEWTRPGLSSPLRPICDLRVLDHFIKEAWDAEAAMRACKDACSIAT
NFTAPLTRVDFDVWEAMNIEEQAQEVQSGLHVLNEAISSLQASNQTDVLQSHIDASISNI
ASIRQVLRSLSIPEYVPPTSGGEDKEMQKVSSVSELFQVHINFLRGKVRLLLANAPVCHQ
GVS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtttcacggttcaggactctttgccttactgctgatggtgctggagtggacccgtcca
ggcctgtcctccccattacgccccatctgtgacctgcgcgtccttgaccatttcattaag
gaggcttgggatgcagaggctgctatgagagcgtgtaaggatgcttgcagcattgccaca
aacttcactgctcctctgacaagagttgattttgatgtctgggaagcaatgaatatagag
gagcaagctcaggaggtccagtcaggcttacacgtgctgaacgaggccatcagctcatta
caggcatctaatcagactgacgtgctgcagtcccacatagatgccagtattagcaacatt
gccagcatcagacaagtgctgcgaagtctcagcataccggaatatgtacctcctaccagt
ggtggagaagacaaggagatgcagaaagtatcctcagtctcagagctgtttcaggtccac
atcaacttcctgcggggaaaagtgcgtcttctgcttgccaatgcacctgtctgccatcaa
ggtgtcagctga

DBGET integrated database retrieval system