KEGG   Sinocyclocheilus rhinocerous: 107752816Help
Entry
107752816         CDS       T04916                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 1B-like
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107752816
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:srx04030]
    107752816
G protein-coupled receptors [BR:srx04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107752816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 107752816
NCBI-ProteinID: XP_016424366
LinkDB All DBs
Position
Unknown
AA seq 386 aa AA seqDB search
MSAGMERSGHFKPTPGHFEVLNASTGTNVTLTPKTDEKQEKSFAFQVTLASVLGLITLAT
ILSNAFVIATISQSRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTHVWSLGQVICD
IWLSSDITCCTASILHLCVIALDRYWAITDAVEYAKKRTQARAAGMVATAWIIAISISLP
PFFWRQVKAGELTTCSVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQWP
KKAGKRLTSAHLSTNSPASVASTSPLHCGRHDLCSDSGSLGSENQIRVTVSDSLLEKKRI
SAARERKATKTLGIILGAYIVCWLPFFIYTLLVPICPSCFYAELFDFFNWLGYVNSLINP
IIYTMSNDDFKKAFHKLISFRCCRRQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgggatggagcgcagcggtcatttcaaaccaacacctggccatttcgaggtt
ttgaacgcctcgaccggcaccaatgttactttaacgcctaaaacggacgaaaaacaagaa
aaaagtttcgcgttccaagtcaccttagcgtccgttctcggtctcatcactcttgcaaca
atattaagcaatgcgtttgtcatcgccaccatttcccagtccagaaagctccagacaccg
gcgaacttcttgatcgcgtccctggccgtcacggaccttctggtgtcggtgctcgtgatg
cccatttgcgtgctttacacggtcacgcacgtgtggtcgcttgggcaggttatctgcgac
atctggctgtcctcagatatcacctgttgcaccgcgtccattcttcacctctgcgtaatc
gccttggatcgatactgggctataacggacgcggtcgagtatgccaagaaacgcacccaa
gcgcgcgccgcgggcatggtggcgaccgcctggatcatcgccatctccatctccctgccg
cctttcttctggcggcaggtgaaggcaggggagctcaccacctgctcggtcaacacggac
cacatcttctacaccatctactccacttttggggctttctacatccctacgctgctgctc
atcgccctgtacgggcggatttacgtggaggcgaggaagcgcattttgaagcagtggccc
aaaaaagcggggaaaagactcacttcggcacatctgagcactaattctcccgcttcggtg
gcttcgacttctcctttgcattgtggaaggcacgacctgtgctcggacagcgggtctctg
ggcagtgagaatcaaattagagtaactgtgtccgattcacttctggagaaaaagagaatc
tcggctgcgcgagagaggaaagccaccaaaaccctgggcattattttaggagcctatatt
gtgtgctggttgccgtttttcatttacacactgctggttcccatctgtccatcctgcttt
tacgcagaactctttgactttttcaattggcttggctatgtcaactcactgatcaatcca
ataatatacaccatgtcgaatgatgactttaaaaaagcttttcacaaactcataagcttt
agatgttgcagacgacagtaa

DBGET integrated database retrieval system