KEGG   Sinocyclocheilus rhinocerous: 107752833Help
Entry
107752833         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2-like isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107752833
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107752833
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107752833
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107752833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 107752833
NCBI-ProteinID: XP_016424383
LinkDB All DBs
Position
Unknown
AA seq 2642 aa AA seqDB search
MDALLNQELREGVKDCSIKVENLPKQVIFKGLAPRVVLTNHLLPKRTKAKVNLEEQGRQK
VSFSFTQTKKPRQNVFLAPASPEKSASEHSSALQAGPVPTPDLAGQSDESKNVDTNTTAA
GETQTAPTPVSFPLKSKHVLGKMHFKKQILSVTVVEDNSIVSTASAEISEPVVPSESDKI
SSSAKVETETSLQQCHKNSVIDSSSEKVIKEENPQEKLDSCLKGPVSSHIGKGDMDSSII
SEHEENRKSQPRSDSTLPGSESDGDSIRTSSSQKSSDRRNKMDSECQSNEAKRSSNSKTK
ELEKSRPDRKEDEKGLSRLKSEHDSRHTSSRSSRSDRDRRRTKSRSRSRSRGCRTSSYSR
SERSRSERPSRSDRSHYHDSERRFHRSSPHRERRSSRSRTDGRSRDSSDSEDDHRRTRTR
GSDSSRSSTYSSSQKDSESSTHSRSHRDSKPTDCSRSSESDKRSQHSKSERSHLKAGDSE
SNRKSSPEAEAVHRNSSAHSKSEINAKTSHSNPATSSRTSEKKVHKNSSDSDEEHRKKRQ
LQGSDRSSVSGTSSSKKTDSADHKTLNNVTGTERQSKDRLSNNTKQSQLVPSPVTPPKEC
SKIDDNSSPPKSKCTSQQMHEATHKVNLVKTNQQTEHQPPNQEGKCTNVPESHKTTDRLK
EFMTSRSLEVRSSTDKPGMKNEIPIQSKALAEGLTDSFCVGHTPDQDSVGSLPDPLSVKE
LPPGGCLKLNTKLDGLSLTISKASMPITQSAQLCEKDSEQHYVNPEQPISGILKKDGSAK
KSRWDIVGQGTSENQSPMKIVNPDVEKVISAKRIEFNNDTTPDESCTQKQGSEVPSEKSV
EGQIRDTSSAESHQKVSPCASDLATQHTHGELINQTVEVPQSTSAPVVSDLPLNCSSGSK
EKINVDKLKPETQNPDSLNHDGKCHSEDSESEESDSDSDDGRVSLKRLHSVVVVPKNSTI
ALEMNDLNDSVFSGQQQTDTHESINREFGCGFNNQSKLEESSALFKASAQTAMPSPDIKC
VSYQSQSNMVDSTSHSEATSGLVDKNRGAQERPNSVQINQASLLSFEKTCMRPESDHHQY
HDRPDSWWNGRKGGKQHYGDSTDFNSGKGYGLAWDFNQSEQPSSTFQQPDSSHGTEHLPK
PGIALFDSGHRPGPLAQPAISETNRPVNAHVPFQYHDSVNQIHPDSLTNDHDDDRVVGIK
QGSILSADLPGSSPFVQAHEISSNCSFTTESQNTSEAPREDNKKPHRGRGPPKKRRPEFE
SESDNEAEAGLTSKKECLDESSRVVKDSKEFFHQIQEVERPLLSLKEFQDPAVWREKAKQ
KKMPPYFDLIEENVYLTERKKNKSHRDIKRMQCECAILSREERSQGMMACGEDCLNRLLM
IECSSRCLNGAYCSNRRFQMKQHAYFEVILTETKGWGLRAAKDLQPNTFVLEYCGEVLDH
REFKARVKEYARNKNIHYYFMALKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQL
RVGFFTTKAVTAGTELTFDYQFQRYGKEAQKCFCGAPSCRGLIGGETRVSVRAAGGKKQR
ERSRKKDTDSALTTLDEELEALQENGEGLCGEKDVISLCRLMVRVETMEQRLTCLKLIEN
TQNPLCLKQFLDHHGLSLLWIFMVELSEAKSNSVNNIKLQLEIMKALAVLPISTKNMLEE
SRVLQFIQRWAQSRPLSQPAEQDGYSSESTSRAQTPLNTPDGPPAKLATELDGDTPKRAV
YRRLKIISENSLDSALSDASKASDGKEEEDEEEEEMEDEPSQLEATIEREVKVENSEAPS
ESQAELEPELKQEPPETEEVTHSTPEATAGEGETLETQEPEEKPLVKPEEQLEDEKIVEE
TKSEEPSESQTESAAVEDAPSVTDTTSAADISNDVVAEVETPITETQVENTSSEQCSSEE
NASCSTAGITPTQPSETIMESVSSESTAVAIESTPTESPSVSVETTPTGSAAVSTEIVSS
EADVAAGSADASALAIVAVPAEGAAVGTPSQDEEEGVSDVESERSQEPQVRASDISDMAA
RLLDSWKDLKEVYRIPKKSQVEKESSDRSRDREALMTPRTPSSSREREREREKERDRDRD
RDRDWERERDWDRDRERDRERDGERSTLRSADRKRRRGSTSPLPPSAYERGRRNDDRYEQ
ASSNKKLHTKESRNKLSTEERRKLFEQEVAQREAQKQQQQQQQQQQQQLQTLAFNPLAYI
SSPNFMAYPPGYPIQTYVDPTNPNAGKVLLPTPAVEPLCVTPAPGTYEQTPTQPIISDLS
LASPSSTTTQAGPASSLSHIPASLELSSGTQTQQFIQPAVPAQDPSVAVLSVSAQTASPQ
VQGQQGYTTLWDPNTQQAVTVQTQPTQQYSTTAQPQTAIYYQGQPCQTIYSIPAGYPQTS
TPVIQTYTEPAASYLHGQQVYTGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNSIVDLPP
PSPPKPKTIILPPSWKVARDPEGRIYYYHIITRQTQWDPPSWDGTTEEASVEHEAEMDLG
TPTYDENPSKFSTKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKLGRISNT
EDFKHLARKLTHGVMNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFGTVYRPKEDTE
LD
NT seq 7929 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctgttgaatcaagagctcagggaaggtgtgaaagattgttcgattaaggtt
gaaaacctcccgaagcaagtcatattcaaaggccttgcacctagggtcgtattgacaaac
catcttctgcctaaaagaactaaggcgaaggtaaaccttgaggaacagggtcgacaaaag
gtctccttcagcttcacacagacaaagaaaccacgtcaaaatgtatttctagccccagca
agcccggagaaatctgcaagtgaacattcttctgcactgcaagctggacctgtacctact
ccagatctagcaggacagagtgatgaatccaaaaatgtggatacaaatactacagcagct
ggggagacccagacagcacccaccccagtatccttccctctcaaatcaaaacatgttctt
ggaaagatgcattttaagaaacagattctcagcgttactgttgttgaggataactccatt
gtcagcactgcctcagcagagatttcggagccagtagtcccatctgagtcagacaaaatt
agttcttcagccaaggttgaaactgaaacctcattgcaacagtgtcacaagaactctgtc
atcgatagttcctctgaaaaagttatcaaagaggaaaaccctcaggagaaattagactca
tgccttaaaggtcctgtttcttcccatattgggaagggagatatggattcttccattatt
tctgagcatgaggaaaacagaaaatcccagcctcgatcagatagcacacttccaggttcg
gagtctgatggggattcaatccgaacatcatctagccagaagtctagtgaccgcagaaat
aaaatggactctgaatgccagagtaacgaagcgaaaagatcctctaattccaaaactaag
gagttagaaaaatccaggcctgataggaaagaagatgaaaaggggttgagtcgtttaaaa
tctgagcatgactccaggcacacatcatcaagatcttctcgttctgacagagaccgaaga
aggaccaaaagtcggtcacggtctagatctcgaggctgtcgaactagttcatattccagg
tctgaaaggtccaggagtgagagaccgtcaaggtcagataggtcacattaccatgattct
gagcggagatttcatagaagttctcctcatcgtgaaaggagaagctcacgttcacgaacc
gatggcaggtctcgtgacagttctgactcggaggatgaccaccggcggacaaggactcga
ggtagtgactcaagtcgatcctccacttactctagctcgcaaaaagactcagaatcatcc
actcactccagatcccacagggactcaaaacccacagattgttctcgatcatctgagtca
gacaaaagatcacagcattcaaagtcagagcgatctcatttaaaagctggtgactctgaa
tccaatagaaagagctctcctgaagcagaagcagttcacaggaactccagtgcccactct
aaatctgagattaatgctaaaacctcacattctaacccagctacctcatcccgaacatct
gagaaaaaggtccataaaaacagctctgactctgatgaggagcacagaaaaaaacgtcag
ttacaaggatcagacaggtcatctgtgtctgggacttcatcttccaaaaaaactgattca
gcagatcacaagactttaaataatgttacaggaacagagagacaatcaaaagacaggtta
agtaataacacaaagcagtcacagttagtccccagcccagttactcctccgaaggaatgc
agcaaaattgatgacaactcttctccgcctaaatctaaatgcacttctcaacagatgcat
gaagctacgcacaaagttaatttggtcaaaacaaatcaacaaactgagcatcaacctcca
aaccaagagggaaagtgcacaaatgttcctgagagtcacaagacaactgatagattgaag
gaattcatgacaagtagaagtcttgaagttagaagttccactgataaacctggaatgaaa
aatgagattccaatccaaagtaaagctctggcagaaggactgactgactcattttgtgta
ggccacactcccgatcaggattcagtaggatcactgccagaccctctttctgtgaaagaa
ttaccacctggaggatgcttgaaattaaacactaaattagatgggctttcactaaccatt
agtaaagccagtatgcccatcacacagagtgctcaactctgtgaaaaagattctgagcag
cattatgtgaatcctgaacaacccattagtgggattttgaaaaaggatggtagtgcaaaa
aaatcccgatgggatattgttggtcaaggcacttcagaaaatcaaagccctatgaaaata
gtgaatccagatgtggaaaaggtcatttcggcaaaaagaatagagttcaacaatgatact
acccctgatgaatcttgcacacagaaacagggctctgaagtaccatctgaaaaatctgta
gaaggacaaatacgagacacatcctcagctgaatctcatcaaaaagtaagtccttgtgca
tctgaccttgcaacccaacatactcatggtgaacttataaatcagactgttgaagttcct
caatcaacaagtgcccctgttgttagtgatcttccccttaattgcagttctggcagtaaa
gagaaaatcaatgtagacaaactaaagcctgaaactcaaaaccctgattccttaaaccat
gatggtaaatgccacagtgaggacagtgagagtgaagaatcggactcagattcagatgat
gggcgtgtttccttaaagcggctgcactctgtggtggttgtgccaaaaaattcaaccatt
gctcttgagatgaatgacttgaatgactctgtgttttctggacagcaacagactgataca
catgaaagcattaatagggaatttggttgtggctttaacaatcagtcaaaacttgaggaa
tcatcagcactttttaaggccagtgcacaaactgcaatgccaagtccagatattaaatgt
gtttcctaccaatcgcagagtaacatggttgacagcaccagccattcggaggctaccagt
ggtcttgtggacaagaaccggggtgcccaagaaagaccaaatagcgtccagataaaccaa
gcatcacttctgagttttgaaaagacttgcatgcgacctgaatcggatcaccatcaatac
catgatagaccagatagctggtggaatggaaggaaaggaggaaagcagcactatggggac
tccactgacttcaacagtggtaagggttatggcttagcctgggactttaaccagtcagaa
cagcccagcagtacatttcagcaaccggacagcagtcatggcactgaacacctgcctaaa
ccaggaattgctctgtttgatagtggtcacagaccaggtccattggctcagcctgccatc
tctgaaaccaacagaccagtcaacgcacatgtgccttttcagtatcatgattcagttaac
cagatccatccagactctttgaccaatgatcatgatgatgacagggtagtagggatcaaa
caaggatctatcctgtctgctgatcttccaggatcatccccatttgttcaagcccatgag
ataagtagcaattgcagcttcaccacagaaagtcagaacacctcggaagctcctagagaa
gacaacaaaaagcctcatcgaggaaggggtccacctaagaagagacgtcctgagtttgaa
tctgaatcggataatgaggcagaggccggtctgaccagtaaaaaggagtgtttggatgag
agctcaagggttgtgaaagatagtaaggaatttttccaccaaattcaagaggtggagcgc
ccactgctcagtctgaaagagttccaggatccagctgtgtggagggaaaaggcaaagcag
aaaaaaatgccaccctactttgacctcatcgaagaaaatgtgtatctgacagaacgcaag
aagaataagtctcatcgagacatcaagcgaatgcagtgtgagtgtgctatcctctcaagg
gaagagcgctcccagggaatgatggcatgtggggaggattgcctcaatcgcttgctgatg
attgagtgctcttcccggtgtttgaatggagcatactgctccaataggcgatttcaaatg
aagcagcatgcatactttgaggtaattttgactgagaccaaaggctggggcttacgagca
gccaaagacctacagccgaacacctttgttttagaatactgtggagaagttttggatcac
cgggaatttaaggcacgggtgaaggagtatgcgcgaaacaagaacattcactattatttc
atggctttgaaaaataatgagataattgatgctactttgaaaggaaactgctcccgtttc
atgaatcacagctgtgaacccaactgtgaaactcagaaatggactgtaaatggccagctc
cgagttggcttcttcaccaccaaagctgtgacagctggaacagaactcacttttgattat
cagttccaaagatacggtaaagaggcccagaagtgtttctgtggagctcctagctgtcga
ggtttaattggtggagagactcgggttagtgtccgagcagcaggtgggaagaaacagagg
gaacgctcacggaagaaagacactgacagtgcgcttaccacgttggatgaggagctggag
gctctgcaggagaatggagaaggcttgtgtggagagaaagatgtgatctcgctctgcaga
ctcatggtgcgagtggagacaatggagcagcgactcacctgccttaaactcatcgagaat
acccagaatcccttgtgcctgaagcagtttttggatcaccacggcttgtcgctgctgtgg
atatttatggttgaactttctgaggctaagagcaattctgtaaacaacattaaactacag
ctggagataatgaaggctctggcagtgcttcccatctcaacaaaaaacatgctggaggag
agccgagtgctacagtttatccagcgctgggctcaaagccggccactcagccaaccagca
gaacaggatggctactccagtgagagcacctcacgtgcccaaacgcccctcaacacccct
gatggtccaccagccaagctggctactgagctggatggagacactcccaagcgggcagtc
taccgtaggttgaagatcatcagtgagaacagtctggacagtgccctgtccgatgctagt
aaagcttcggatgggaaagaagaggaagatgaggaagaggaagagatggaggatgagcct
tcacagttggaagccacaattgaaagggaggtaaaagtagaaaacagtgaagcgccttct
gagagtcaagctgagcttgagcccgaattaaaacaggagccccctgaaaccgaagaagtc
acacattcaacaccagaggccactgccggtgaaggagagacacttgaaacacaagaacct
gaagaaaaacccctcgttaagcctgaagaacaactggaggatgagaagattgtggaagag
accaagagtgaggagccatcagagtcccagacagagtcagcagcagttgaagatgcccct
tcagtcacagacaccacatctgcagcagacattagtaatgatgtagttgctgaagtggaa
actcccataactgagacccaggtggaaaacacatcttctgaacaatgcagctccgaagag
aatgcaagttgcagcactgcaggaatcacacccacgcaaccgtcggaaaccataatggag
agcgtctcctctgaatccacagctgttgccatagagagcacacccacagaatctccatct
gtctctgtggaaaccactccaactggatctgctgctgtttctactgaaattgtgtcatca
gaggctgacgtagccgccggttctgctgatgcatcggccctggctattgtggctgttcca
gcagagggcgctgcagtggggacgccttctcaagatgaggaggaaggtgtttctgatgtc
gaaagtgagcgcagtcaggagccacaagttcgggcttctgatatcagtgatatggccgcc
cggctgctggacagttggaaagacttaaaggaagtttacaggataccaaagaagagccag
gttgaaaaagagtcaagtgatcgcagtcgtgatcgagaagccctgatgacccctcgcaca
ccttcgagcagtcgagagagagagcgagaaagagagaaggagcgtgatcgggatcgagac
cgggacagagactgggagcgtgaacgagactgggaccgtgaccgtgagcgggaccgggag
agggatggagagagatcgactcttcgcagtgcagatagaaaaaggcgacgaggctccacc
tcccctctgccgccttcagcttatgagaggggccgcagaaatgatgaccgttatgagcag
gccagcagcaataagaaactccacaccaaagagtctcgtaacaagctgtctactgaggaa
cgacgaaagctcttcgagcaggaagtggctcagcgggaggcccagaaacaacaacaacag
caacaacaacagcagcagcagcaattacagactcttgcgtttaacccactggcctacatc
tccagtccaaacttcatggcctacccgcctggataccctatccagacctacgtggatccc
accaatcccaatgcaggaaaagtgctcctgcccacacctgctgtagagcctctttgtgtc
accccagctcctggtacatatgaacaaacacctacacagcccatcatatcagatctcagt
ctagcttcaccctcttccaccaccacccaggccggacctgcctccagcttgtcacatatc
cctgcctctctggagctttcctctggcacacagactcagcagtttatccagcctgctgtg
ccagcacaggacccgagcgtggctgtcttgtcggtgtctgcgcaaacagccagcccacag
gtccagggtcagcagggctacacaacgctctgggaccccaacacacagcaagcggtcacg
gtacagacacaaccgacccagcaatactccaccacggcacagcctcagactgccatctac
tatcagggccagccctgccagaccatctatagcattcctgcaggctacccacaaaccagc
actcctgtcatacagacatacactgagccagctgccagttacctacatgggcagcaggtg
tacacgggtcatcagcagggtgtggttgtgcagcagggaggcacagtcaccaccattgtc
acatctcagacagttcaacaggaaatgatcgtacccaacagcatcgttgatctgccaccc
ccttcccctcccaaacctaaaaccattatcctgcctcccagttggaaagtggcgcgagac
ccagagggcagaatctattactatcacatcatcaccaggcaaacacagtgggatcctccc
agctgggatgggactacagaggaagccagtgtagaacacgaggctgagatggacctcggg
acgcccacatacgatgaaaatccttcaaagttctctacaaagaccgccgaggctgacacg
tccagtgagctggccaaaaaaagcaaagaagtcttccgcaaggagatgtcacagtttatt
gtgcaatgccttaatccgtaccgcaaaccagactgcaagctgggccgtatcagtaacaca
gaagacttcaaacatctcgctagaaagctgactcatggggtgatgaacaaggaactgaag
tcttgcaagaatcctgaagatcttgaatgcaatgagaacgtcaaacacaagaccaaggag
tacatcaagaagtacatgcagaagtttggcactgtgtaccggcccaaggaagacacagag
ctggactaa

DBGET integrated database retrieval system