KEGG   Sinocyclocheilus rhinocerous: 107753094Help
Entry
107753094         CDS       T04916                                 

Definition
(RefSeq) glucokinase-like
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00010  Glycolysis / Gluconeogenesis
srx00052  Galactose metabolism
srx00500  Starch and sucrose metabolism
srx00520  Amino sugar and nucleotide sugar metabolism
srx00524  Neomycin, kanamycin and gentamicin biosynthesis
srx01100  Metabolic pathways
srx01200  Carbon metabolism
srx04910  Insulin signaling pathway
Module
srx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107753094
   00052 Galactose metabolism
    107753094
   00500 Starch and sucrose metabolism
    107753094
   00520 Amino sugar and nucleotide sugar metabolism
    107753094
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107753094
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107753094
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     107753094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107753094
NCBI-ProteinID: XP_016424680
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MPCLTSARRQGMLSDFESVLERILMVEQILSEFLLSKEDLEEVMRRMRREMERGLRVETH
NEASVKMLPTYVRSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHHMYSI
PEDTMTGTAEMLFDYIAGCISDFLDKHNLKHKKLPLGFTFSFPVRHEDLDKGILLNWTKG
FKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHSCEVGMIVGTGC
NACYMEEMHKVELVEGEEGRMCVNTEWGAFGDNGELEDFRLEYDRVIDETSLNPGHQLYE
KLIGGKYMGELVRLVLLKLVNENLLFNGEASDLLKTRGAFETRFVSQIESDTGDRKQIYN
ILSTLGILPSELDCDVVRLVCESVSTRAAHMCGAGLAGVINLMRERRCQEQLKITVGVDG
SVYKLHPHFKERFHKLVWEINPHCEITFIQSEEGSGRGAALISAVACKMATCMLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtcttacttcagctcgtaggcaagggatgctgagtgactttgagtcagtactg
gagagaattctcatggtggagcaaattttgtctgaatttctgttgagtaaagaagatcta
gaggaagtgatgaggagaatgcggagagagatggagaggggactgcgagtggagacacac
aatgaagccagcgtcaaaatgctgcccacttatgtccgctccacacctgaaggctctgag
gttggtgatttcctggcactggatcttggagggacaaactttcgagtgatgctggtgaaa
gtgggtgaggatgaagagcgcggctggaaggtggagacgaagcatcacatgtactccatt
cctgaagacaccatgactggcacagctgaaatgttgtttgattacattgccggctgcata
tctgacttcctggacaaacataatctgaaacataagaagcttccactgggattcaccttc
tcttttccagttcgtcatgaggatttggacaagggcattctgcttaactggactaaaggc
ttcaaggcctctggtgctgagggaaataacgttgtgggtctactgagagacgccattaaa
agaagaggggactttgaaatggatgtggttgccatggtgaatgacacagtagccacaatg
atctcctgctactatgaagaccacagctgtgaagttggcatgatagtaggtaccggctgt
aatgcgtgttatatggaggagatgcataaggtggagctggtggagggagaggaggggagg
atgtgtgtgaacacagagtggggagcgtttggggacaatggtgaactggaggacttccgg
ctggagtatgatcgcgttattgatgagacatcactaaaccctggacatcagctgtatgag
aagctgattggtggaaagtatatgggggagcttgtgcgtcttgtgctgctaaaactagtg
aatgaaaatctgctgtttaacggcgaagcctcagacctgctgaaaacacgtggagctttt
gaaactcgcttcgtctcccagattgagagtgacacaggggacagaaagcagatctacaac
atcctaagcacactgggaatcttaccatcggagctggactgtgacgttgtgcgtctggtc
tgtgagagcgtgtctacgcgagccgctcacatgtgcggggccggcctcgctggcgtcatc
aacctaatgagggaacgccgctgtcaagagcaactgaagatcactgttggagtcgatggc
tctgtctacaaactacaccctcatttcaaggagcggttccataagcttgtgtgggaaatt
aatcctcactgcgaaattaccttcatccaatcagaagaggggagcggtcggggcgcggct
ctcatttccgctgtggcatgcaagatggccacctgcatgctgacaccgtga

DBGET integrated database retrieval system