KEGG   Sinocyclocheilus rhinocerous: 107755213
Entry
107755213         CDS       T04916                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04144  Endocytosis
srx04510  Focal adhesion
srx04540  Gap junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107755213
   04020 Calcium signaling pathway
    107755213
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107755213
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107755213
   04540 Gap junction
    107755213
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107755213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107755213
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:srx04090]
    107755213
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107755213
Protein kinases [BR:srx01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107755213
CD molecules [BR:srx04090]
 Proteins
  107755213
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig Ig_5 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 107755213
NCBI-ProteinID: XP_016427418
LinkDB
Position
Unknown
AA seq 1411 aa
MRFLETHLVLGIVLLGVFSDVSKPWPVINSDQKEFILKPHSEFTITCSGERRVTWVEPLP
PNSEVQSGFNHSTLVITDAEASNTGYYTCFYEDQPEKDTDIYIFVLDPEVPFVSEPAVET
DEIGTTIPCRATNPHSQVLLRNLQSGDEVSVLYDHRIGFFGVLSPGHYVCETSVNGNAVQ
SIVYNVTNDTDVKDDDDEEKSFNIKLSASMEDVKEGDAVNLTCETPPGKAFHQQWLHPQK
QARDAVPIKLTFPDKVQYILNIPKASVADTGHYECAVTNQFTGQTKSLILGITIHESSFV
EVISNGIGPVVVVSLLEEKEFTIYIDADPEPKVRWFKDGLQLDDSYISTKTTHLEGLRYE
NILVLRHPIEEDSGVYEIVASTGSRTSRFSFKLLVEAMYPELPQSVLAPVMWPQRDSMEV
SLHSTFRLTCRGQAELSWYSPVYLHDQFDTEKKGLFISTVTVGNATAAHTGKYICYYDSS
NNTEETSIYIYVPDPETPFVPSMTPFENHVLTTHDEMEIPCRVTDPSASISLIHIETSQV
LPSVYDSKRGFIGLFSAGTYVCRALTNGQTHDSIEYIVHGWTGGSDVQVELRAEKKALLV
GETITVDCIARNSEILEDHWKYPGKLAGRGVKTVKENKRDLEIHYTLTVTNASPKDSGVY
ACSITDVKSNESQTKQLTITVYGHEFVHINPVIGPVETTRLDEVREFRVDIQSFPAPKVT
WLKDESVLGDVAAEITTNLLKIDETSYQGVLTLIRAKAEDSGNYTIRAETGSQTASNSFY
LQVKVPPVIVDLMDIHHGSAGGQEVVCTAGGSPAPDVDLYICKNIKHCANDSSQWMPLPI
NSTDITVELQMDVDNNIESHIIFHHLESTIAVRCLARNDMGAVSREIKLVSNGPRSELTV
AAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWE
FPRDSLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDGFLSRRTEKGKKELDI
FGINPADESSRSYVILSFEGKGDYMDMKQADTMQYVPMLEMSEASKYSPIQRSDYDHPPS
HRQFNESELENLLSDDTNEGLTAVDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLSQG
KIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIF
SLGGTPYPGMVVDSNFYNKIKSGYRMAKPEHTSSDVYELMMKCWNSEPEKRPSFHSLSDT
VASLLPSEYKRCYERVNHDFLKSDHPAVTRVQCIDNDDAYMGVLYKNQGKMKDRESGFDE
QRLSSDSGYIIPLPDLDPLSNEDYSKRNRHR
NT seq 4236 nt   +upstreamnt  +downstreamnt
atgaggttcctggagacacatctcgttttggggattgtcttactaggggtattttcagat
gtttcaaaaccttggccggttattaattcagatcaaaaggaatttattctcaaacctcat
tctgagttcaccatcacttgctccggagagaggagagtgacatgggtcgagcctttaccg
cccaacagtgaagtgcagtccggatttaatcacagcactttggtgatcactgatgctgag
gcctctaacacaggatactacacctgtttttatgaggatcaacctgaaaaagacactgat
atctacatttttgttctagatcctgaggttccattcgtgtctgaacctgctgttgagaca
gatgagataggcacaactatcccctgccgcgctacaaacccacattctcaagtgcttctc
agaaacctgcagagtggggatgaagtttctgtactttacgaccacagaatcggctttttc
ggtgtattatcaccaggtcactatgtttgcgagacgagtgtgaatggcaatgcagtgcag
agcatcgtttataatgtgacaaatgacacggatgtcaaagatgatgatgatgaagagaag
agcttcaacataaagctgagtgccagtatggaggatgtgaaagagggggatgctgtcaat
ctgacctgtgagacgcctcctgggaaggctttccaccagcagtggctgcatccccaaaaa
caggccagagatgctgttccaatcaagttaactttcccagacaaggttcagtacatcctc
aacatcccaaaagcctctgtggcagacactgggcactatgagtgtgctgttaccaaccaa
ttcactggacaaaccaagtctctcatcctgggaatcacaatccacgagagctcttttgtg
gaagtaatatctaatggcattgggccagtggtggttgtgtcgcttctggaggaaaaagag
ttcactatttacattgatgctgaccctgagccaaaggtcaggtggtttaaagatggcctt
cagctggatgacagctacatctccaccaagaccactcatctggaaggcctcaggtatgag
aatattctggttctccgtcaccccatagaggaggacagtggcgtctatgagattgttgca
tccactggttccaggacttcaagattttcattcaaactgctagttgaagccatgtaccca
gagctgccacagtcagtgctggctccagtcatgtggccccagagggacagcatggaggtg
tctctccactccactttccgactcacatgtcgaggtcaggccgagctctcctggtacagc
cctgtttatctccacgatcagttcgacactgaaaaaaaaggactcttcatctccactgtg
actgttggcaatgcgacggccgcccatacaggaaaatacatctgctactatgactccagc
aacaacactgaagagacctccatctatatttatgtgccagatccagaaacgccgtttgtg
ccatctatgaccccttttgaaaaccatgtgctgacgactcatgatgaaatggagattccg
tgccgtgtgacggaccccagtgccagcatctctctgattcacattgagaccagtcaggtt
ctgcccagtgtctatgacagcaagagaggattcattggcctctttagcgctgggacgtat
gtctgcagggccctcactaacggacagacgcatgacagcatagagtacatcgttcatggc
tggacaggagggtctgatgtgcaagtcgagctgcgagcagagaagaaagctctgctggtg
ggtgagaccatcactgttgactgtatagccagaaacagtgagatactggaggaccactgg
aaataccctgggaaactggcgggtcgaggagtaaagacagtaaaggagaataagcgagat
cttgagatccattatactctgacagtgactaatgcctcaccaaaagacagcggcgtctat
gcttgctccatcactgatgttaagagcaatgagagccaaaccaaacagctcactattaca
gtctatggtcatgagtttgtgcacataaatccagtgattggtccagtggagactactagg
ctggacgaggtgcgagagttcagggtggacatacagtctttccctgcccccaaagtcaca
tggttaaaggatgaatcggtcctgggagatgttgctgcagagatcaccaccaacctccta
aaaatcgatgagaccagttaccaaggcgtgttgaccctgatcagggctaaagcagaggac
agtgggaattataccatcagggcagaaacaggcagccagactgccagcaacagtttctac
cttcaggttaaagttccccctgtgattgtggacctgatggatatccaccacggctctgct
ggaggtcaggaagtggtgtgtactgctggtggctcccccgcccctgatgtggacttgtat
atctgtaaaaacattaaacactgtgccaacgattcctcccagtggatgccacttccgatc
aactctacggacatcacagtggaactgcaaatggatgtggacaacaacattgagagtcac
atcatcttccaccatcttgagagcacaattgctgtacgctgtctggccaggaatgacatg
ggcgctgtttcacgagagattaaactcgtgtcaaatggtccgcgctcggagctcactgtg
gctgctgctgttctggtgctgctggtcattgtcatcatctcactcattgtgctggtcatt
atctggaaacagaaaccacgttatgagatcagatggcgcgtgattgaatcggtcagtccg
gacggtcacgagtacatctatgtcgaccccatgcagcttccatatgactcccgctgggag
ttccctcgggattcacttgtactgggtcgtgtcctgggctcaggagcatttgggaaagtg
gtggaaggcactgcttatggactcagtcgttctcaacctgtgatgaaagtggcagtgaaa
atgcttaaaccgacagcacgctccagtgagaaacaggctttgatgtcagagctgaaaatt
atgacccacctgggccctcacctaaacattgtcaaccttctgggagcgtgcaccaagtca
ggaccaatctacattatcacagagtattgtttctatggagacctggtgaattacctgcat
aagaacagagatgggtttctcagccgccgcacagaaaagggcaagaaagagctagacatc
tttggcatcaacccagccgatgagagtagcaggagctacgtcatcctatcttttgagggg
aaaggtgattatatggacatgaaacaggcagacaccatgcagtacgtccccatgctggaa
atgagtgaagcctcaaaatactcccccatccagagatcagactatgaccatcctccctct
cacagacagttcaacgagagtgaacttgagaaccttctctcagatgacaccaatgaaggc
ctgacggcagtggacctcctcagtttcacctatcaggtggctcgagggatggagttcttg
gcctctaagaactgtgtacacagagacttggctgcacgtaatgtcctgctgtctcaaggc
aagatagtgaagatctgtgactttggactggccagagacatcatgcacgataacaactac
gtctccaaaggaagtactttccttccagtaaaatggatggcccctgagagtatctttgat
aacttgtacactacacttagtgacgtctggtcttatggcatcttattatgggagatcttc
tctcttggagggactccttatccaggtatggttgtggattccaacttctacaacaagatc
aagagtggataccgaatggcgaaacccgagcacacttccagtgatgtctatgagcttatg
atgaagtgttggaacagtgaaccagagaagagaccatctttccacagcctgagtgatacg
gtggcctctctgctgccctctgaatataagaggtgctacgaacgcgtgaaccatgacttc
ctgaagagcgatcaccccgctgtgactcgggtgcagtgcattgacaatgatgatgcgtac
atgggtgtgctctacaagaaccagggcaaaatgaaggaccgcgagagcggctttgatgaa
cagagactcagctctgacagcggctacatcattcctctgccggacctcgacccgctgtca
aatgaagactacagcaagaggaaccgccacaggtag

DBGET integrated database retrieval system