KEGG   Sinocyclocheilus rhinocerous: 107755676Help
Entry
107755676         CDS       T04916                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00052  Galactose metabolism
srx00500  Starch and sucrose metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107755676
   00500 Starch and sucrose metabolism
    107755676
Enzymes [BR:srx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107755676
    3.2.1.20  alpha-glucosidase
     107755676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107755676
NCBI-ProteinID: XP_016428050
LinkDB All DBs
Position
Unknown
AA seq 1811 aa AA seqDB search
MGKRCFSGLEETLMVLFALVTLLHTGEPRTIRDDSVSVQNVVPECPSIPYGERVDCFPHP
DASEQKCLERACCWSPVDEANVPWCFFSKNHGYSVVSESQPDSTHIEARLTRMDAPSLFG
ADIKELIFYAEMQTENRLRFKITDANQARFEVPHEHVQAPSSPPTGPLKYRLELIQKPFG
LKVWRTSPEKLLFDTTIGPLVFADQYLQLSAKLSSHNIYGLGEHVHQTFRHDTDWRTWPI
FTRDSFPNGGTHNLYGHYPYFTCLENESGQSFGVFLMNSNAMEVTIQPAPAITYRTIGGV
LDFYILVGDTPEAVVDEFTQLIGRPFIPPYWSLGFQLSRWDYGSLDEVKKVVERNRQIGI
PYDVQYTDIDYMEDKKIFTYDMEKFKELPQFADYMHENGQKYIVILDPAVSTGKRLNGPY
EALDRGHAAKVWVTEPDGNTPLIGEVWPGETVFPDYTNQACVDWWVDEISRFHKEVKHDA
LWIDMNEVANFVQGSSKGCAENKLNYPPFTPRILDNLMYSKTLCMDAKHKWGNHYDVHSL
YGYSMVLATEKASREVFKTNRSMVFTRSSFPGVGKYAGHWLGDNAANWNDIKWAIPGMLE
FNLFGVPYIGADICGFFDDSPEELCRRWMQVGAFYPFSRNHNAQGYKDQDPAAYGAVSLL
VKTSKHYLNIRYTLLPYLYTLFYKAHVNGETVLRPMMHEFYSDSETWGVHNQFLWGAHLL
ITPVLDPGVENVEAYIPDAIWYDFEKEERITDRKEKVNLNLPADKLGLHLRGGAILPAQR
PDVTTTYSRRHPMRLIIALDDNNAASGELFWDDGESRDTVSSGSYIHYQFSVANDVLTMH
VTHNGYTDPNNLKFENITVMGVTGAPVSVLVSDGTTTNALTESQVNYDSTRKVLYLRNLE
LELGKNYTVNWQDKYRNSRHFDCHPEAGSDQAKCEARGCIWEPSNVPNEPWCYYPDTHGY
ITSNVVETASGITVDLERNTAFPSQRSQSRDISKLRVEITYLSGKSLRWKIFDPSNARYE
VPVPLDLPAMPETEENNRLYRVQINNKPFGIQVIRKDTEEIIWDSAVPGLTFSDQLLEIS
TLLPSNYVYGFGETEHPIYKHDLNYHKYGLFTKDQPPGYKLNSYGVHPFYMGLEKSKYAH
GVLLLNSNAMDVTFLPTPALTYRTVGGILDFYMVMGPTPEAVVQQYTEMIGRPVLPAYWS
LGFQLCRYGYSKDAEIADLYRDMKAAKIPYDVQYADIDYMERQMDFTLDKVNFKGLPALV
DNMRAEGMRFIFILDPAIAANETKGSYPAFDTGVEKDIFIKWPPELSNDIVWGKVWPDYP
NITVDNSLDWDTQVELFRAFVAFPDFFKSSTAEWWAQQIKDFYNNVMKFDGLWIDMNEPA
TFVHGTVGEKCLGDPALENPPYMPPLESMHRGLNHKTLCMNSEQILADGTRVRHYDVHNL
YGWSHTKPTYDALLSATEKRGVVVTRSTYPSSGRWAGHWLGDNYSAWDQLLKSIIGMMEF
SIFGIPYTGADICGFFNPAQYEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFAAI
SRDVLNIRYTLLPYLNTLMYEAHAHGNTVVRPLLHEFVSDENTWSIDRQFLWGPALLITA
ALDPGVSVVRGYVPNARWYDYHTGEVVGVRGQFMNMDTPLSKINLHVRGGHILPWQKPEN
NTHYSRLNPLGLLVALDDGGSAHGSLFWDDGEGIDTVQNKRFLLTSFSVSSGVLTNAVLT
DGLAEADRLTLGVVKVWGVSAPVTQVIMKVTGKPDAKLEFTYNAEVQELQLDATSQSHTI
EKPFTITWSTA
NT seq 5436 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcggtgcttctcagggttggaggagaccctgatggtgttgtttgcattggtc
actttactgcacactggagaaccaagaacaatcagagacgattcagtatcagttcaaaac
gttgttccagaatgtcccagcattccatacggcgagagagtggactgcttcccacatccc
gacgcttccgagcaaaaatgcttggaaagagcttgctgctggagccctgtggatgaggct
aacgttccctggtgcttcttctccaaaaaccacggctacagcgtggtcagcgaaagccag
cctgacagcacacatattgaggccaggctgacaagaatggatgctccatctctatttgga
gctgacattaaagagttgatcttctacgctgaaatgcagactgaaaaccgtcttcgattt
aagatcacagatgcaaaccaagccaggtttgaggttcctcacgagcatgtacaagcgcct
tccagccctcccaccggacccctcaaatatagactggagctgatccagaaaccctttgga
ctgaaagtttggagaacatctcctgaaaaactcctgtttgacacaaccattgggccgctg
gtttttgcggatcagtaccttcaactctcggctaaactctcctctcacaatatttatgga
ctcggagaacacgtccatcagaccttccgccatgacaccgactggaggacctggcctatc
ttcacaagagattcttttcccaatggcggcacacacaacctgtacggccactacccctat
ttcacatgtcttgaaaatgagagcggccagtcctttggtgttttcctcatgaacagcaat
gctatggaggtgacaatccagcctgctccggccataacctaccggactatcggaggggtt
ttggacttctacatcctggttggagacacaccagaagcagtggtggacgagttcacacag
ctgattggcaggcctttcattcctccgtactggtctctgggtttccagctctctcgctgg
gactacggcagcctggacgaggtgaagaaagtcgtggagaggaaccgacagatcggcatt
ccgtatgatgtccagtacactgatatcgactacatggaggacaaaaagatcttcacctat
gatatggagaaatttaaggagctgcctcagtttgctgactacatgcacgagaatgggcag
aaatacatcgtcatattggatcctgctgtgtccacaggtaaaaggctaaatggaccatat
gaagcacttgaccggggacatgcagctaaagtttgggtcactgaaccagatgggaacacg
cctctaataggagaggtctggccaggggaaaccgtgtttcctgactacactaaccaggct
tgcgttgattggtgggttgatgaaatttcacgtttccacaaagaagtcaagcatgatgct
ctctggattgacatgaatgaggtggccaatttcgtacagggaagcagcaaaggctgcgct
gagaacaaactcaactatcctccattcactccacgtatccttgataacctgatgtacagt
aagaccttatgtatggatgctaaacacaaatgggggaaccactatgatgtccacagtctc
tatgggtactcgatggtcctggccactgagaaggcatcgagagaagtgtttaagacaaac
cgttccatggtttttacccgttcctccttccctggggtgggcaagtacgctgggcactgg
ttgggtgacaatgccgccaactggaatgacattaagtgggcaatacccggcatgctggag
tttaacctctttggagtcccttacattggcgcagacatctgtgggttcttcgacgactcg
ccggaggagctttgcagacgttggatgcaagtcggcgcgttctaccccttcagccgtaac
cacaacgcacaagggtacaaggaccaggaccctgcagcatatggcgccgtctctctcttg
gtgaaaacctccaagcattacctgaacatcagatacaccctcttgccgtacctctacact
ctcttctacaaggcccacgtcaacggagagactgtattgcgtcccatgatgcacgagttc
tattccgacagtgaaacctggggagtgcacaaccagttcttgtggggagcacatcttctc
atcacacctgtgttggatcctggtgttgaaaatgtggaggcctacattccagatgccatc
tggtatgactttgagaaggaggaacggattaccgatcgcaaagaaaaagtcaacttgaac
ctgcctgctgataaacttggtttacacctgagaggcggagccattctgcccgcacaaagg
ccagacgtcaccactacatacagccgacgtcatcccatgagactgatcatcgctctcgat
gacaacaatgctgcatcaggagagctattttgggatgacggagagtctcgagatactgtt
tcatccggctcctacattcattaccagttttctgtggctaatgatgtcttgacaatgcat
gtcacccacaatggctacacagatccaaacaacttgaagtttgagaacatcactgtaatg
ggagtgaccggagctccagtctctgtgctcgtgtcagacggcaccactactaatgctctg
accgagtcccaggttaactacgattctacccggaaggtgttgtacctgagaaacctggag
ctggaactggggaagaactacacagtcaactggcaggacaaatacagaaactctaggcac
ttcgattgtcatcctgaagcaggttccgatcaggccaaatgtgaagcccgtggctgcatc
tgggagccttcaaatgttcccaacgagccctggtgttattaccctgacacccacggctac
atcaccagcaacgtggttgaaacggcgagtggcatcactgtagatttagagcgcaatacg
gctttcccaagtcaacgttctcaatctcgagacatcagcaagctccgtgtggaaatcaca
tacctgagtggcaaaagcttgcgttggaagatctttgacccaagcaatgcacgctacgag
gtccccgttcccctcgacctgcccgccatgccagagacagaggaaaacaacagactgtac
agggttcagatcaataacaagccttttgggatccaagtcatcagaaaggacacagaagaa
atcatatgggactctgccgtgccagggctcacattctccgatcagctccttgagatctcc
acgctcctgccctcaaactacgtctatggttttggtgaaacagagcaccccatctacaaa
catgacctcaactatcacaaatacggcctgtttaccaaagaccagcctccagggtataag
ctgaacagttatggagtccatcccttctacatgggtctggagaaatcaaaatatgctcac
ggcgtcctcctgctcaacagcaatgccatggatgtcaccttcttgcctactccagctctg
acctaccgcaccgtcggaggcatcctggacttctacatggtgatgggacccactccagaa
gctgtggttcagcagtacactgagatgatcggccgcccggttcttccagcctattggtcg
cttggattccagctttgtcgttacggctactccaaagatgcagagatcgcagatctttac
agagacatgaaagctgctaaaattccttatgatgttcaatatgcagacattgactatatg
gagaggcagatggactttacgctggacaaagtgaacttcaagggactgcctgctctggtg
gacaacatgagggctgaggggatgcgcttcatcttcatattggacccggctatagcagcc
aatgagacaaaaggctcctaccctgcatttgataccggggttgaaaaagacattttcatc
aaatggcctcccgagctcagcaatgacattgtgtggggaaaggtgtggcctgattatccc
aatattactgtggacaattctttggactgggatactcaagtagagctattcagagctttc
gtggcgttccctgatttcttcaagagcagtacagcagaatggtgggcacagcagattaaa
gacttttacaacaacgtcatgaagtttgatggactttggatcgacatgaatgagccggcc
actttcgtgcatggcaccgtcggagagaaatgcctaggggatcccgctttggaaaaccct
ccatacatgccccctctggagtccatgcacagaggcctgaaccataagactttatgcatg
aacagcgagcagatcctggctgatggcacacgcgtcaggcattatgatgtccacaactta
tatggctggtctcacacgaaacctacttatgatgctttgcttagtgccactgaaaagaga
ggtgtcgtagttacccgttcaacatatccgtctagtggtcgctgggcaggacattggctg
ggagacaactactccgcctgggaccagcttctcaagtccatcataggcatgatggagttc
agcatatttggcatcccttacaccggtgctgatatctgtggcttctttaaccctgcccaa
tacgagatgtgcctgcgttggatgcagcttggagctttctacccattctccagaaaccac
aacaccataaacatgccaaggcaggatcccgtggcctggggaccagagtttgctgctatc
tctcgtgatgtgctgaatattcgctacaccctcctgccgtatttgaacacactgatgtac
gaagctcacgctcacggaaacactgtggtcagacctctgcttcatgagtttgtgtcagat
gaaaacacatggagcatcgacaggcagttcctctggggtcccgcgcttctcatcacagct
gctttagacccgggcgttagtgtggtcaggggctacgtgccaaacgcccgctggtacgac
taccacacgggtgaagttgttggagtgcgaggacagttcatgaatatggatacaccgtta
tcgaaaattaacctgcacgtgagaggaggccacatcctgccctggcagaaaccagagaac
aacacacactacagtcgtctgaatcctctgggtcttcttgttgctcttgatgatggaggt
tcagcacatggatccttgttctgggatgacggagagggaattgatactgttcagaacaag
cgtttcctcttgacgtctttctctgtgtcttcgggtgttcttaccaacgcagttctcaca
gatggtctggccgaggccgacaggttgaccctgggtgtcgtgaaggtgtggggtgtgtca
gcgcccgtcactcaagttatcatgaaagtgactggaaagcccgatgccaaattggaattc
acgtataacgctgaggttcaggagctgcagcttgatgcaacatcacagtctcacaccatc
gagaagcctttcaccatcacctggagcacagcttag

DBGET integrated database retrieval system