KEGG   Sinocyclocheilus rhinocerous: 107756015
Entry
107756015         CDS       T04916                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
srx  Sinocyclocheilus rhinocerous
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 107756015
NCBI-ProteinID: XP_016428466
LinkDB
Position
Unknown
AA seq 366 aa
MAKCELIELQDLTPDDRIELAPPSGPLPRDGPTLERWSKEKVVRMVGERVRLEDPDWLTC
KPGWGHDFQPCSQTQLSWCDLCGEFIWGLYRQNLRCTHCNYTCHYRCQPFIQLDCSLNCD
AVSKQLNYCEDTIETDTNVDEPVDCRKQELSLSEIQQKVKEYNAQVNSNLFMVLNRDGSY
TGFIKVQFKLARPVSLPPPQSTSSSSSSSSSGRDGGCQEDKALKHRTSFYLPRDTVKHLH
ISSSTRAREVIKALLKKFTVVDNPAKFSLFERSERQNQVYLRKLADDEHPLFLRLCAGPN
EKVLSLVLKENETGEVNWDAFSFPELQNFLRILKREEEDHVRQIVRRYALARDKMKEALK
NFSTPG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcaaaatgtgagcttattgaactgcaggacttgactccagatgaccgcatcgagtta
gcgccccctagcggccctctgccccgcgatgggcccactctagaaaggtggagcaaagag
aaggtggtacggatggtgggggagcgcgtgcgtctggaggaccccgactggctgacgtgt
aaaccgggatggggacacgacttccagccctgcagccagacgcagctgagctggtgcgac
ctctgcggagagttcatctggggcctgtaccgccagaacctccgctgcacacactgtaat
tacacttgtcactaccgctgtcaacccttcattcaactggactgcagcttgaactgcgac
gccgtcagcaaacagctaaactactgcgaggacacgatcgagacggacactaatgtggat
gagccagtggactgcaggaaacaggagctgtccctcagtgaaatacaacagaaagtgaaa
gaatacaatgctcaggtcaacagtaacctcttcatggttctgaaccgtgatggatcttac
actggcttcataaaggtccagttcaagctggcccggcccgtgtctctccctcctccacag
agcacgtcttcctcctcctcctcctcctcctcgggacgggatggcggttgtcaggaagac
aaagcactgaagcaccgcacctcattttacctgcccagagacacggtcaaacacctgcac
atcagctccagcacgcgggccagagaggtcatcaaagccctgctgaagaaattcactgtg
gtggacaatccggccaagttctcactgtttgaacgcagtgaacgacagaatcaagtgtac
ttaaggaagttagcagatgacgaacatccgcttttcctgcgcctgtgtgctggacccaac
gagaaagtcctcagtttggtccttaaagagaatgaaacgggggaagttaattgggatgcg
ttcagttttcctgaactccagaacttcctgcgcatcctgaagcgggaggaggaggatcac
gtgcggcagatcgtgcggcgctacgctctggccagagacaagatgaaagaagctctgaag
aacttcagcacgccgggctga

DBGET integrated database retrieval system